KEGG   Actinoplanes sp. SE50/110: ACPL_226Help
Entry
ACPL_226          CDS       T02044                                 

Gene name
purA
Definition
(GenBank) adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase00230  Purine metabolism
ase00250  Alanine, aspartate and glutamate metabolism
ase01100  Metabolic pathways
Module
ase_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:ase00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ACPL_226 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ACPL_226 (purA)
Enzymes [BR:ase01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     ACPL_226 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AEV81125
UniProt: G8S4S8
Position
complement(121832..123124)
Genome map
AA seq 430 aa AA seqDB search
MPVIVLVGAQWGDEGKGKATDLLGDRLDYVVKFNGGNNAGHTVVIDGEKYALHLLPSGIL
SPNVVPVIGNGVVVDLNVLFQEIDGLEARGIDTSRLRVSANAHVIASYNRSLDKVSERFL
GARRIGTTGRGIGPTYADKMNRVGIRVQDLFDESILRQKVTAALAFKNQVLSKIYNRSAV
KAEDVVQELLSYVDRLRPYVADTALELSQALDAGKVVLCEAGQATLLDVDHGTYPFVTSS
NATSGGACTGSGIPPTRIDRVVAVLKAFTSRVGEGPFPTELHDKWGDYLREVGHEYGTTT
GRPRRIGWLDLVIGRYATRINGVTDFAMTKLDNYDGLDEIPVCVAYDVNGVRHDEMPVNQ
TDFHHAKPIYETLPGWKQDISGCRKFEELPREAQDFVEFVEARIGARISIVGVGPGREAV
IERHSVLGEA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtgccggtgatcgtgttggtcggcgcccagtggggcgacgagggcaagggcaaagccacg
gacctgctgggcgaccggctcgactacgtggtgaagttcaacggcggtaacaacgcgggc
cacaccgtcgtcatcgacggcgagaagtacgcgctgcacctgctcccgagcgggatcctc
tccccgaacgtcgtgccggtgatcggtaacggtgtcgtcgtcgacctcaacgtgctgttc
caggagatcgacggactggaagcccgcggcatcgacacctcccggctgcgggtcagcgcc
aacgcgcacgtgatcgcgtcgtacaaccgctcgctcgacaaggtctccgaacgcttcctc
ggcgcccgccggatcggcaccaccggccgcggcatcggccccacctacgccgacaagatg
aaccgggtcggcatccgggtgcaggacctcttcgacgagtcgatcctgcggcagaaggtg
accgccgccctcgccttcaagaaccaggtcctgtcgaagatctacaaccgcagcgcggtc
aaggccgaggacgtcgtccaggaactgctgtcctacgtcgaccggctccggccgtacgtc
gcggacaccgccctggagctctcccaggccctggacgccggcaaggtcgtgctctgcgag
gccggccaggccaccctgctcgacgtcgaccacggcacctacccgttcgtgaccagctcg
aacgcgacctcgggcggtgcctgcaccggttccggcatcccgcccacccggatcgaccgg
gtggtcgccgtactcaaggcgttcaccagccgggtcggcgagggccccttccccaccgag
ctgcacgacaagtggggcgactacctgcgtgaggtcggtcacgaatacggcaccaccacc
ggccgcccccgccggatcggctggctcgacctggtcatcggccggtacgcgactcggatc
aacggcgtcaccgacttcgcgatgaccaaactggacaactacgacggcctcgacgagatc
ccggtctgcgtggcgtacgacgtgaacggtgtccggcacgacgagatgccggtcaaccag
accgacttccaccacgccaagccgatctacgagacgctgcccggctggaaacaggacatc
tccggctgccgcaagttcgaggagcttccccgcgaggcgcaggacttcgtcgagttcgtc
gaggcccggatcggcgcccggatctcgatcgtcggcgtcggcccgggccgcgaagcggtc
atcgagcggcactcggtgctcggcgaggcgtag

DBGET integrated database retrieval system