KEGG   Actinoplanes sp. SE50/110: ACPL_2500Help
Entry
ACPL_2500         CDS       T02044                                 

Gene name
fadB
Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase00071  Fatty acid degradation
ase00280  Valine, leucine and isoleucine degradation
ase00281  Geraniol degradation
ase00310  Lysine degradation
ase00362  Benzoate degradation
ase00380  Tryptophan metabolism
ase00410  beta-Alanine metabolism
ase00640  Propanoate metabolism
ase00650  Butanoate metabolism
ase00903  Limonene and pinene degradation
ase00930  Caprolactam degradation
ase01040  Biosynthesis of unsaturated fatty acids
ase01100  Metabolic pathways
ase01110  Biosynthesis of secondary metabolites
ase01120  Microbial metabolism in diverse environments
ase01130  Biosynthesis of antibiotics
ase01200  Carbon metabolism
ase01212  Fatty acid metabolism
Module
ase_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ACPL_2500 (fadB)
   00650 Butanoate metabolism
    ACPL_2500 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    ACPL_2500 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    ACPL_2500 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ACPL_2500 (fadB)
   00310 Lysine degradation
    ACPL_2500 (fadB)
   00380 Tryptophan metabolism
    ACPL_2500 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ACPL_2500 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ACPL_2500 (fadB)
   00281 Geraniol degradation
    ACPL_2500 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ACPL_2500 (fadB)
   00930 Caprolactam degradation
    ACPL_2500 (fadB)
Enzymes [BR:ase01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ACPL_2500 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ACPL_2500 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ACPL_2500 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH NAD_binding_2 F420_oxidored adh_short_C2 Sacchrp_dh_NADP DAO Shikimate_DH UDPG_MGDP_dh_N AlaDh_PNT_C adh_short NAD_binding_8 NAD_Gly3P_dh_N ApbA
Motif
Other DBs
NCBI-ProteinID: AEV83395
UniProt: G8S0P0
Position
complement(2702052..2704082)
Genome map
AA seq 676 aa AA seqDB search
MISYDKDEAGIVTLTMNDPDQSANTMNATYVAAMSAALDRLEAERDQVTGVIVSSAKSTF
FAGGDLPTMSRARPEDAGALFDLLGTIKKDLRRLETYGRPVVAAINGAALGGGFEIALAC
HHRIALDAPGTRVGFPEVTLGLLPGAGGVTRTVRMLGLAPALTVWLLTGKRVKPAAAREA
GMIDEVVSSQDEMMARAREWIAANPDAAQPWDRPGYRMPGGTPATPKLAVQLPAFPATLR
KQLKGNRMPAPEAILATAVEGAQVDIETAFTIETRRLITLLTGRIAKNMIGAFFFDMRAV
NGGAARPRVDVAPATRIAVLGAGMMGAGIAYACAQAGLEVVVKDVSREAAARAVAEGDPA
VLARITPTADVEDLRGCDVVIEAVFEDPKLKHQVFAEVEPVLAAGALLASNTSTLPITGL
AEGVTRPGDFIGMHFFSPVGKMPLLEIMVGEQTSDAAIARAFDLGRRIGKTPIVVNDGRG
FFTSRVIGQFMNEAVAMLAEGVPAASIEQAALQAGYPTGPLALADEVTLTLMHKIHKAYA
AAGTTAGPAKAHALIQEMLERHDRPGRSSGRGFYTYENGRRGRLWDGLAGLATDEGRAIP
FADVQERLLFSEALDALRCRAEGVLRTDADGNIGSILGIGFPAWTGGVLRYVEQHPDFKG
RAAELAARYGDRFAPA
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
gtgatctcttacgacaaggacgaggccggcatcgtcacgctgacgatgaatgacccggac
caatcggcgaacacgatgaatgccacctacgtcgccgccatgagcgccgccctcgaccgc
ctggaggcggagcgggaccaggtcaccggcgtgatcgtgagcagcgcgaagagcaccttc
ttcgccggcggcgacctgcccacgatgagcagggcccgcccggaggacgccggcgccctg
ttcgacctgctgggcacgatcaagaaggacctccggagattggagacgtacggtcgtccg
gtcgtcgccgcgatcaacggcgccgccctgggcggcggtttcgagatcgccctcgcctgc
caccaccggatcgccctggacgcccccggcacccgggtcggcttccccgaggtgacgctg
ggcctgctcccgggcgccggcggcgtgacccgcaccgtccggatgctcggcctggctccc
gccctgaccgtctggctgctcaccggcaaacgcgtgaagccggccgcggcccgggaagcc
ggaatgatcgatgaggtcgtctcatcgcaggacgagatgatggcccgggccagggagtgg
atcgccgccaacccggacgccgcccagccgtgggacaggccgggctaccggatgcccggc
ggcaccccggccaccccgaagctcgcggtccagctgccggccttcccggccaccctgcgc
aagcagctcaagggcaaccggatgccggccccggaggcgatcctggccaccgcggtggag
ggcgcccaggtcgacatcgagaccgccttcaccatcgagacccgacggctgatcacgctg
ctcaccggccggatcgcgaagaacatgatcggcgcgttcttcttcgacatgcgcgcggtc
aacggcggcgccgcccggccgcgggtcgacgtcgccccggccaccagaatcgccgtgctg
ggtgccgggatgatgggcgccggcatcgcctatgcgtgtgcgcaagccggcctggaggtc
gtggtcaaggacgtgtcgcgggaggcggcggcccgcgcggtggccgagggtgacccggcc
gtgctggcccggatcacgccgaccgccgacgtcgaggacctgcgcggctgcgacgtggtg
atcgaggcggtgttcgaggacccgaagctcaagcaccaggtgttcgccgaggtcgagccg
gtcctcgccgcgggcgccctgctcgcctcgaacacctccaccctgccgatcaccggtctg
gccgagggggtgacccggcccggcgacttcatcggcatgcacttcttctcgccggtcggc
aagatgccgctgctggagatcatggtcggcgagcagacctcggacgccgcgatcgcccgc
gccttcgacctgggccgccggatcggcaagacgccgatcgtggtgaacgacggccgcggc
ttcttcaccagccgggtgatcggccagttcatgaacgaggcggtcgcgatgctggccgag
ggggtgccggccgcgtcgatcgagcaggcggcgctgcaggccggctacccgaccgggccg
ctcgcgctggccgacgaggtgacgctgacgctgatgcacaaaatccacaaggcgtacgcg
gcggccgggaccaccgccggtccggcgaaggcgcacgcgctgatccaggagatgctggag
cggcacgaccgacccggacgatcctccggcaggggcttctacacctacgagaacggccgg
cgcggcagactgtgggacggcctggccgggctcgccaccgacgagggccgcgccatcccc
ttcgccgacgtgcaggaacgcctgctgttcagcgaggcgctggacgcgttgcgctgccgg
gccgagggcgtgctgcggaccgatgccgacggcaacatcggttcgatcctcggcatcggc
ttcccggcctggaccggcggcgtgctgcgctacgtcgagcagcaccccgacttcaagggc
cgggccgccgagctggccgcccggtacggcgaccggttcgccccggcatga

DBGET integrated database retrieval system