KEGG   Actinoplanes sp. SE50/110: ACPL_3098Help
Entry
ACPL_3098         CDS       T02044                                 

Gene name
rmlC
Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase00521  Streptomycin biosynthesis
ase00523  Polyketide sugar unit biosynthesis
ase01130  Biosynthesis of antibiotics
Module
ase_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    ACPL_3098 (rmlC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ACPL_3098 (rmlC)
Enzymes [BR:ase01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     ACPL_3098 (rmlC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom FdtA
Motif
Other DBs
NCBI-ProteinID: AEV83993
UniProt: G8SBL4
Position
3370349..3370960
Genome map
AA seq 203 aa AA seqDB search
MKVRPLSIEGAWEVTPARFGDDRGTFLEWYRFDHLSAAVGHRLDLAQANLSTSARGVVRG
VHFADVPPGQAKYVTCVSGAVLDVVVDVRAGSPTFGRWEAVTLDDTDRRAVYLAEGLGHA
FCALTEGAVVAYLCSATYRPGHEHGVHPLDPELGIAWPAGTPLLSPKDAAAPSLSEALAA
GLLPRYDTCRDYVETMRRDDDSE
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtccggccgttgagcatcgagggtgcctgggaggtcacgccggcccggttcggc
gacgatcgcggcaccttcctggagtggtaccgcttcgaccatctgagcgcggcggtcggg
catcggctggacctggcccaggcgaacctgtccacctcggcccggggggtggtgcgcggg
gtgcatttcgccgacgtgccaccgggccaggcgaagtatgtgacgtgtgtgtccggcgcg
gtcctcgatgtggtggtggacgtccgggccggctcgccgaccttcgggcggtgggaggcg
gtgaccctggacgacaccgaccggcgcgcggtctatctggccgagggtctcgggcacgcg
ttctgcgcgctgaccgagggcgccgtggtcgcctacctctgctcggccacctaccggccg
gggcacgagcacggcgtccacccgctcgatcccgagctgggcatcgcctggccggccggg
acgccgctgctgtcgccgaaggacgcggccgcgccgtcgctgtccgaggcccttgcggcc
gggctgctgccacggtatgacacatgccgtgactacgtcgaaacaatgcgtcgcgatgac
gacagtgaatag

DBGET integrated database retrieval system