KEGG   Actinoplanes sp. SE50/110: ACPL_3679
Entry
ACPL_3679         CDS       T02044                                 

Gene name
acbO
Definition
(GenBank) 2-epi-5-epi-valiolone-7-phosphate 2-epimerase
  KO
K19974  2-epi-5-epi-valiolone 7-phosphate 2-epimerase [EC:5.1.3.35]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase00525  Acarbose and validamycin biosynthesis
ase01100  Metabolic pathways
ase01110  Biosynthesis of secondary metabolites
Module
ase_M00814  Acarbose biosynthesis, sedoheptulopyranose-7P => acarbose
Brite
KEGG Orthology (KO) [BR:ase00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    ACPL_3679 (acbO)
Enzymes [BR:ase01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.35  2-epi-5-epi-valiolone 7-phosphate 2-epimerase
     ACPL_3679 (acbO)
SSDB
Motif
Pfam: AP_endonuc_2 DUF3197
Other DBs
NCBI-ProteinID: AEV84574
UniProt: Q8RMD1
Position
4076083..4076895
AA seq 270 aa
MTCRVGLTEWRLAPSGAAAIRLAAAVGADGIQLDFGGPGRGVLVDGPGRAGQLRAVADEA
GVDLLALAGNLLNDIGLTSQPAVVQPVLARLADTATELGVPLLIVPSFRRSAITDAMSFT
RTAAALRWAVSLAEARGIVLASENVLPPARARQLVEEVGSPAFRLLLDTFNPVRYGLDPA
WLATELRPWWADQIHLKDGPPDTGPSPLLGAGQGGVRRTLTALRGSPAPVRALVLENDYR
DGHGARLRADLEWARRAAVNARESEKGKLT
NT seq 813 nt   +upstreamnt  +downstreamnt
gtgacctgccgggtggggctgaccgagtggcggctggcgccctcgggtgcggcggccatc
cggctggccgcggcggtcggtgccgacgggatccagctcgacttcggcggcccgggccgt
ggcgtgctggtggacggcccgggccgtgccgggcagctgcgggcggtcgccgacgaggcg
ggagtggacctgctcgcgctggccggcaacctgctcaacgacatcgggctcacgtcgcag
ccggcggtggtccagccggtgctggcccggctggccgacacggcgaccgagctcggggtg
ccgctgctcatcgtgcccagcttccggcgcagcgcgatcaccgacgcgatgtccttcacc
cgcacagcagccgccctgcgctgggccgtgtcgctggccgaggcccggggaatcgtgctg
gccagcgagaacgtcctgcccccggcgcgggcccggcagctggtcgaggaggtcggctca
ccggctttccggctgctgctggacaccttcaacccggtccggtacggactcgacccggcc
tggctggccaccgagctccggccgtggtgggccgaccagatccacctcaaggacggcccg
ccggacaccgggccgtcgccgctgctcggtgcgggacagggcggggtgcggcgcaccctg
accgcgctcagggggagccccgcaccggtacgggccctggtgctggagaacgactaccgc
gacggccacggtgcgcggctgcgagcggacctggagtgggcccgccgggccgcggtgaac
gcgagagaatccgagaaagggaagctgacgtga

DBGET integrated database retrieval system