KEGG   Actinoplanes sp. SE50/110: ACPL_3844Help
Entry
ACPL_3844         CDS       T02044                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase00260  Glycine, serine and threonine metabolism
ase00750  Vitamin B6 metabolism
ase01100  Metabolic pathways
ase01110  Biosynthesis of secondary metabolites
ase01120  Microbial metabolism in diverse environments
ase01230  Biosynthesis of amino acids
Module
ase_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACPL_3844
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ACPL_3844
Enzymes [BR:ase01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ACPL_3844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEV84739
UniProt: G8S121
Position
complement(4257763..4258191)
Genome map
AA seq 142 aa AA seqDB search
MSAVLSPFPAQVGAGADDGLPRLLVGQPERWATIADTVNGVDRAGRGERVPTVAEGAAIA
SPVRLPEAVEALRRCGGAAVAVAEEQIHGAVRALATRGLYAEPTSAVAAAALDHFIADGT
ITPDQTTVVVLTGSGLKSADKR
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgtgctgtcccccttcccggcccaggttggtgccggagcagacgacgggctg
ccccggctgctcgtcgggcagcccgagcgctgggccaccatcgccgacaccgtcaacggc
gtcgaccgggccggacgcggtgagcgggtgccgaccgtcgctgaaggggcggccatcgcc
agccccgtacggctgccggaggccgtcgaggccctgcgtcgctgtggcggcgcggcagtc
gccgttgccgaggaacagattcacggtgcggtccgcgccttggctacccgcggcctgtac
gccgaaccgaccagtgccgtcgcggcggccgcactcgaccacttcatcgctgacggcacc
atcactcctgatcagacgactgtggtcgtgctcaccggctcggggctgaagtcggccgac
aagaggtaa

DBGET integrated database retrieval system