KEGG   Actinoplanes sp. SE50/110: ACPL_4503Help
Entry
ACPL_4503         CDS       T02044                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase00071  Fatty acid degradation
ase00280  Valine, leucine and isoleucine degradation
ase00281  Geraniol degradation
ase00310  Lysine degradation
ase00360  Phenylalanine metabolism
ase00362  Benzoate degradation
ase00380  Tryptophan metabolism
ase00410  beta-Alanine metabolism
ase00627  Aminobenzoate degradation
ase00640  Propanoate metabolism
ase00650  Butanoate metabolism
ase00903  Limonene and pinene degradation
ase00930  Caprolactam degradation
ase01100  Metabolic pathways
ase01110  Biosynthesis of secondary metabolites
ase01120  Microbial metabolism in diverse environments
ase01130  Biosynthesis of antibiotics
ase01212  Fatty acid metabolism
Module
ase_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ACPL_4503
   00650 Butanoate metabolism
    ACPL_4503
  Lipid metabolism
   00071 Fatty acid degradation
    ACPL_4503
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ACPL_4503
   00310 Lysine degradation
    ACPL_4503
   00360 Phenylalanine metabolism
    ACPL_4503
   00380 Tryptophan metabolism
    ACPL_4503
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ACPL_4503
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ACPL_4503
   00281 Geraniol degradation
    ACPL_4503
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ACPL_4503
   00627 Aminobenzoate degradation
    ACPL_4503
   00930 Caprolactam degradation
    ACPL_4503
Enzymes [BR:ase01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ACPL_4503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: AEV85394
UniProt: G8SEU3
Position
4908551..4909561
Genome map
AA seq 336 aa AA seqDB search
MGTDEEVIVEVREGLGHLVLNRPRAINALTAGMVAIMRRALAGWAASDTVRAVLITGAGE
RGLCAGGDIRAIHADAVSGGSGSIRFWADEYELNATIAEYPKPVVALMDGLVMGGGIGVS
AHASVRVVTERSRLAMPEVGIGMHPDVGGSWLLSRAPGELGTHLALTGSAVGAADGIAAG
LADFFVPSERLPALVAALEQGQGVRAFTAEPPPGEFATAREWIDVCYRGDSVIEIVDRLA
RHPAPGAQAAAKEIGTRSPTALTITLRSLRTAARLPDLRAALGQELRLSAAMLRLPDLAE
GIRAQIIDKDRNPRWRPSSLAEVRPETVDEVFEATR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgggtaccgatgaggaagtgatcgtcgaggtccgggaaggcctcgggcacctggtcctg
aatcggccgcgggcgatcaacgcgctcaccgccggcatggtggcgatcatgcgccgggct
ctggccgggtgggcggcgtcggacaccgtgcgggccgtgctgatcacgggagcgggtgag
cgcgggctctgcgccggcggtgacatccgggcgatccacgcggacgcggtgtccgggggc
agcgggtcgatccggttctgggctgacgagtacgagttgaacgcgacgatcgcggagtat
ccgaagccggtcgtggcgctgatggacggtctcgtgatgggtggcgggatcggtgtctcg
gcgcacgcgtcggtgcgggtggtgacggagcggtcccggctggcgatgcccgaggtgggc
atcggcatgcacccggacgtcggcggctcctggctgctctcccgggcgcccggcgagctg
ggcacgcatctggcgctgaccggctccgcggtgggggcggcggacgggatcgcggccggg
ctcgccgacttcttcgtcccgtccgagcgcctgcccgcgctggtcgcggcgctggaacag
gggcagggggtgcgggccttcacggccgagccgccgccgggtgagttcgccacggcccgg
gagtggatcgacgtctgctaccggggggactcggtgatcgagatcgtggaccggctggcc
cggcacccggccccgggcgcgcaggcggccgccaaggagatcggcacccgctcccccacc
gccctgacgatcaccctgcgttcgctgcggacggcagcgcgcctgcccgatctgcgcgcc
gcgctggggcaggagctgcggctgtcggcggccatgctgcggctgccggacctggcggag
gggatccgggcgcagatcatcgacaaggaccgcaatccgcgctggcggccgtcgtccctc
gccgaggtgcggccggagaccgtcgacgaggtgttcgaagcaacccgttag

DBGET integrated database retrieval system