KEGG   Actinoplanes sp. SE50/110: ACPL_5685Help
Entry
ACPL_5685         CDS       T02044                                 

Gene name
plcN
Definition
(GenBank) phospholipase C
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase00562  Inositol phosphate metabolism
ase00564  Glycerophospholipid metabolism
ase00565  Ether lipid metabolism
ase01100  Metabolic pathways
ase01110  Biosynthesis of secondary metabolites
ase02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ase00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    ACPL_5685 (plcN)
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ACPL_5685 (plcN)
   00565 Ether lipid metabolism
    ACPL_5685 (plcN)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ACPL_5685 (plcN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:ase02042]
    ACPL_5685 (plcN)
Enzymes [BR:ase01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     ACPL_5685 (plcN)
Bacterial toxins [BR:ase02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   ACPL_5685 (plcN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756
Motif
Other DBs
NCBI-ProteinID: AEV86572
UniProt: G8SC31
Position
6223721..6225688
Genome map
AA seq 655 aa AA seqDB search
MLGMPAVAAAMPAGLEKALAIPANNRTGSIEDVEHVIFLMQENRSFDHYFGTLRGVRGFA
DPHPATLPSGKSVWHQRNGDGELLPFRPDVPDLGGSFLPDPPHGWDDTHGAWNGGRYDGW
VPNKGVETMTHHTRADLPYHFALADAFTVCDNYHCSLLGPTDPNRYHMWTGWVGNDGTGG
GPVITNAEAGYDWTTYPERLEKAGVSWKVYQDVGLGLTAAGSWGWTSDPFIGNYGDNALL
YFHRYQNAQPGDPLADRAKTGTEVNRLGRAPERLLTDFRTDVENGTLPRVTWIVAPEAYT
EHPNWEPHNGAWYISQVIDILASNPAIWSKMALFVTYDEEGGFFDHLIPPTPDPARSTVS
TVNEIFTGAGHPAGPYGLGIRVPMIVVSPWTRGGWVNSQTFDHTSLIRFLERRFGVTEPN
ITPWRRAVAGDLTGAFDFRTPNRRPVDLPDTAALKPSDLTRQPDLVPVPPTEARLPRQER
GVRPARALPYALHADLTGDTLVLRNVGRATAVFHVRPSGADPVSFTVEPGKHLTGDFTAA
EVEVHGPNGFYRRFRRGTSPIETRARYVEHHDTVLLEIRNTGRDRAEVTVSDRYTGHAST
LTLRGGTTRTSQINTTRTRGWYDVTITVGDTVQQYAGHLENGRDSITDPGMGGLL
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgctgggcatgccggcggtggccgccgcgatgcccgcggggctggagaaggccctcgcc
attccggcgaacaaccgcaccgggtcgatcgaggacgtggagcacgtcatcttcctgatg
caggagaaccgttccttcgaccactatttcggcacgctgcgcggggtgcgtgggttcgcc
gatccgcatccggcgaccctgccgagcgggaagagcgtgtggcatcagcgcaacggggac
ggtgaactgctgccgttccggccggatgtgccggacctgggcggctcgttcctcccggac
ccaccgcacggctgggacgacacgcacggcgcgtggaacggcgggcggtacgacggctgg
gtgccgaacaagggtgtcgagacgatgacccatcacacccgagccgacctgccgtaccac
ttcgcgctggccgacgccttcacggtgtgcgacaactaccactgttcgctgctcgggccg
accgacccgaaccggtaccacatgtggaccggctgggtcggcaacgacggcacgggcggc
ggcccggtgatcaccaacgccgaggcggggtacgactggaccacctacccggagcgcctg
gagaaggccggcgtctcgtggaaggtctaccaggacgtggggctcgggctgaccgcggcc
ggctcctgggggtggacgtcggacccgttcatcggcaactacggtgacaacgccctgctc
tacttccaccggtatcagaacgcgcagcccggtgacccgctggcggaccgggcgaagacc
ggcaccgaggtgaaccgactcggccgcgccccggagcgactgctgaccgatttccgcaca
gacgtggagaatggcacgctgccgcgggtcacctggatcgtggcgccggaggcgtacacc
gagcacccgaactgggagccgcacaacggcgcctggtacatctcgcaggtgatcgacatc
ctggcgtcgaacccggcgatctggtcgaagatggcgctgttcgtcacgtacgacgaggag
ggtggcttcttcgaccacctgatcccgccgacccccgacccggcccgttcgaccgtctcc
acggtcaacgagatcttcaccggggccgggcatccggccgggccgtacgggctgggcatc
cgggtcccgatgatcgtcgtctcaccgtggacccgcggcggctgggtcaactcgcagacc
ttcgaccacacctcgctgatccggttcctggagcgccgcttcggcgtcaccgaaccgaac
atcacgccctggcggcgggccgtggccggcgacctgaccggtgctttcgacttccgcacg
ccgaaccggcggccggtggacctgccggacaccgcggcgctgaaaccgtccgacctgacc
cggcagcccgacctggtcccggtcccaccgaccgaggcgagactgccccggcaggagcgc
ggtgtacgtcccgcccgggccctgccctacgccctgcacgccgatctcaccggcgacacg
ctggtgctgcgcaacgtcggccgggccacggcggtcttccacgtccggccctcgggcgcc
gacccggtgtccttcaccgtcgaaccgggcaagcacctgaccggcgacttcaccgccgcc
gaggtggaggtgcacggtccgaacggcttctaccgccgcttccggcgcggcacctccccg
atcgaaacccgggcgcggtacgtcgaacaccacgacacggtcctcctggagatccggaac
accggccgggaccgcgccgaggtgaccgtttcggatcggtacaccgggcacgcgtcgacg
ctcaccctgcgcggcggcaccacccgcacctcgcagatcaacaccacgagaacccgcggc
tggtacgacgtgaccatcaccgtgggtgacaccgtccagcagtacgccgggcacctggag
aacggtcgggacagcatcaccgacccgggcatgggcggactgctctga

DBGET integrated database retrieval system