KEGG   Actinoplanes sp. SE50/110: ACPL_6641Help
Entry
ACPL_6641         CDS       T02044                                 

Gene name
ggt
Definition
(GenBank) gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase00430  Taurine and hypotaurine metabolism
ase00460  Cyanoamino acid metabolism
ase00480  Glutathione metabolism
ase01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ase00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    ACPL_6641 (ggt)
   00460 Cyanoamino acid metabolism
    ACPL_6641 (ggt)
   00480 Glutathione metabolism
    ACPL_6641 (ggt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ase01002]
    ACPL_6641 (ggt)
Enzymes [BR:ase01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     ACPL_6641 (ggt)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     ACPL_6641 (ggt)
Peptidases and inhibitors [BR:ase01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   ACPL_6641 (ggt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept BtrH_N
Motif
Other DBs
NCBI-ProteinID: AEV87523
UniProt: G8S7E3
Position
complement(7290876..7292645)
Genome map
AA seq 589 aa AA seqDB search
MRFLSALAALSLTSLSLTAVSAPALAATGSTAQGYGGAIATVDATATAAGLEVLRRGGNA
VDAAVAAAATLGVTEPFASGIGGGGFFVYYDAHRHRVFTIDGREKGPASMTPTYFVNPVT
GQPYAFDEARVSGLSVGVPGTLATWEAAARQWGTRPLSRALDDAAEVADRGYTVDGEFRR
QVTENAAAFGQFDATRALYLPGGAPPAIGTVIRNPDLADTYRLIARKGTAVFYRGPVGAD
ILQTVTRPPVSSSPSSPWAYPIRPGVLTAEDLASYQVRRPAPTRSDYQGLSVYGMSTPSS
GGTAVGEALNILDASPLDSASTVEKLHYYLEASALAFADRGRYVGADTPRPVLDTLLSDR
WARQRACQIDPHHALVKPVAAGPSGCTAAAGADTPDTGMSTTNLTVADRWGNVVEYTLTL
EQFGGNGMVVPGRGFMLNNELTDFNFTGTQGDNPDPNLPGPGKRPRSSMSPTIVLKDGRP
YLAAGAPGGSTIITTVLQILYGRLELGLTLPQAVAAPRAAQRNTAGIQAEPAFHTTYGPE
LTALGHVFGPDAAEIGAATAIEFGPCGSQLAVAEPVRRGGGSAGVVHPR
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgcggttcctttccgcgctagcagcgctttcactcaccagcctgtcgttgaccgcggta
tcggcgcccgccctggccgccaccgggtcgacggcgcagggctacggcggcgcgatcgcc
accgtcgacgccaccgccaccgccgccgggctggaggtgctgcgccgcggcggcaacgcg
gtcgacgccgcggtcgccgcggccgccaccctcggcgtgaccgagccgttcgcctccggg
atcggcggcggcggcttcttcgtctactacgacgcccaccggcaccgggtcttcaccatc
gacgggcgggagaagggccccgcgtcgatgacccccacctacttcgtgaacccggtgacc
gggcagccgtacgccttcgacgaggcccgggtcagcggcctctcggtcggcgtgcccggc
accctggccacctgggaggcggccgcccgccagtgggggacccggccgctgtcccgggcg
ctcgacgacgccgccgaggtggccgaccgcggctacaccgtcgacggcgagttccgccgc
caggtgaccgagaacgccgccgcgttcggacagttcgacgcgaccagggcgctctacctg
ccgggtggcgcgccgcccgcgatcgggacggtgatccgcaacccggatctggccgacacg
taccggctgatcgcccgtaagggcaccgcagtcttctaccgcggaccggtcggcgccgac
atcctgcagaccgtcacccggcccccggtgtcgtccagcccctcctcgccctgggcctac
ccgatccgccccggcgtgctgaccgccgaggacctcgcttcgtaccaggtccgccgtccg
gcgccgacaagatccgactaccagggcttgtcggtgtacggcatgtccaccccgtcgagc
ggcggtaccgccgtgggcgaggcgctcaacatcctggacgcgtccccgctcgactccgcg
tcgaccgtcgagaagctgcactactacctggaggcctcggcgctcgcgttcgccgaccgg
ggccgctacgtcggcgcggacaccccgcgcccggtcctggacaccctgctctccgaccgg
tgggcgcggcagcgggcctgtcagatcgaccctcaccacgcactggtcaagccggtcgcg
gccgggccgtccgggtgcaccgcggcggccggcgcggacaccccggacaccgggatgagc
accaccaacctgaccgtggccgaccggtggggcaacgtcgtcgaatacacgctcaccctg
gaacagttcggcggcaacggcatggtcgtgcccggccgcggcttcatgctcaacaacgaa
ctgaccgacttcaacttcaccggcacccagggcgacaatccggacccgaacctgcccggc
cccggcaagcgcccgcgcagctcgatgtcgccgaccatcgtgctcaaggacggccggccg
tacctcgcggccggggcgccgggtgggtcgacgatcatcacgaccgtgctgcagatcctg
tacgggcggctcgaactcgggctgaccctgccgcaggcggtcgccgcgccgcgggccgcg
cagcgcaacaccgcgggtatccaggccgagcccgcgttccacaccacgtacgggccggag
ctgaccgcgctcggccatgtcttcgggccggacgcggcggagatcggcgccgccactgcg
atcgaattcggtccgtgcgggtcgcagctcgcggtcgccgagccggtccgccggggcggt
gggtcggccggggtcgtgcatccgcgttag

DBGET integrated database retrieval system