KEGG   Actinoplanes sp. SE50/110: ACPL_7069Help
Entry
ACPL_7069         CDS       T02044                                 

Definition
(GenBank) hypothetical protein
Organism
ase  Actinoplanes sp. SE50/110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3037
Motif
Other DBs
NCBI-ProteinID: AEV87949
UniProt: G8SFF8
Position
7808367..7808735
Genome map
AA seq 122 aa AA seqDB search
MRIPYEYAVIQAVPRVERGELINVGVLLYCQRHDFLSARTHLTESRLLALDPSADVPAVR
AALDSWEATCRGGGASAGMRLGERFRWLVAPRSTILRAGPVHMGLTVEPAAELERLVGLL
VH
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgaggatcccctacgagtacgcggtgatccaggccgtgccgcgggtcgagcgcggtgag
ctgatcaacgtcggggtgctgctctactgccagcgccacgacttcctctcggcccgcacc
cacctgaccgagtcccggctgctggccctcgacccgtccgccgacgtgcccgccgtccgc
gccgccctggactcctgggaggccacctgccggggcggcggcgcctcggccgggatgcgg
ctcggcgagcggttccgctggctggtcgccccgcgcagcaccatcctgcgggccgggccg
gtccacatgggcctcaccgtggaaccggccgccgagctggagcgactcgtcgggctactg
gtgcactga

DBGET integrated database retrieval system