KEGG   Actinoplanes sp. SE50/110: ACPL_7081Help
Entry
ACPL_7081         CDS       T02044                                 

Gene name
wrbA
Definition
(GenBank) Trp repressor binding protein
  KO
K03809  NAD(P)H dehydrogenase (quinone) [EC:1.6.5.2]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase00130  Ubiquinone and other terpenoid-quinone biosynthesis
ase01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ase00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    ACPL_7081 (wrbA)
Enzymes [BR:ase01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.2  NAD(P)H dehydrogenase (quinone)
     ACPL_7081 (wrbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMN_red Flavodoxin_5 Flavodoxin_2 Flavodoxin_1
Motif
Other DBs
NCBI-ProteinID: AEV87961
UniProt: G8SFH0
Position
complement(7819936..7820541)
Genome map
AA seq 201 aa AA seqDB search
MADVKLAIIYYSATGTLHRMAQRLQEAAEKAGADVRLRQVAELAPPEAIASNAAWSQHFD
TTKDEPRAAADDVVWADAVLFGTPTRYGNVASQLKQFIDTLGPQWAQGQLANKAYAGFTA
SMTEHGGQESTLLALYNTIYHFGGVVVAPGYTDPLKFADGNPYGVSHVTGGSNDAPLTDV
QYAALDHLARRIVQIGGRLRA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtggcagacgtcaagctcgcgatcatctactactcggccaccggcaccctgcacaggatg
gcgcaacgcctgcaggaggcggccgagaaggccggtgccgacgtgcgcctgcggcaggtc
gccgagctcgccccgcccgaggcgatcgcctcgaacgcggcctggagccagcacttcgac
accaccaaggacgagccgcgggccgccgcggacgacgtggtctgggccgacgcggtgctg
ttcggcacgcccacccggtacggcaacgtggccagccagctcaagcagttcatcgacacg
ctgggcccgcagtgggcgcagggacagctggcgaacaaggcgtacgccgggttcaccgcg
tcgatgaccgagcacggcggccaggagtcgacgctgctggccctctacaacacgatctac
cacttcggcggggtggtggtggcgcccggctacaccgacccgctgaagttcgccgacggc
aatccgtacggcgtctcgcacgtcaccggcggctcgaacgacgcgccgctcaccgacgtg
cagtacgccgccctcgatcacctggcgcgccgcatcgtccagatcggtggccgcctgcgg
gcctag

DBGET integrated database retrieval system