KEGG   Actinoplanes sp. SE50/110: ACPL_7084Help
Entry
ACPL_7084         CDS       T02044                                 

Definition
(GenBank) uncharacterized protein
Organism
ase  Actinoplanes sp. SE50/110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chlor_dismutase
Motif
Other DBs
NCBI-ProteinID: AEV87964
UniProt: G8SFH3
Position
complement(7821389..7822090)
Genome map
AA seq 233 aa AA seqDB search
MSEQTNAARINELNATIRYTMWSVFRASSPLPALRDELAGEVDTLFEQLAAKDVTIRGTY
DVSGLRADADLMIWWHAADSDDLQEAYSLFRRTALGRHLTPVWSQMALHRPAEFNKSHLP
AFLAGEEARPYLCVYPFVRSYEWYLLPDAERRELLAEHGRQARGYPDVRANTVASFALGD
YEWMLAFEADELHRIVDLMRDLRASRARRHVREEVPFYTGRRRSISEIAASLP
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcagaccaatgcggctcggatcaacgagctgaacgccaccatccgctacacg
atgtggtcggtcttccgggcgtccagcccgctgccggccctgcgcgacgagctggccggc
gaggtcgacaccctgttcgagcagctcgcggcgaaggatgtgacgatccgcggcacctac
gacgtgtccgggctgcgcgccgacgccgacctgatgatctggtggcacgccgccgactcg
gacgacctgcaggaggcgtactcgctgttccggcggacagccctgggccggcacctgacc
ccggtctggtcgcagatggcgctgcaccggccggccgagttcaacaagagtcacctgccg
gccttcctcgccggcgaggaggcgcggccctacctgtgcgtctacccgttcgtccgctcc
tacgagtggtatctgctgcccgacgccgagcggcgcgagctgctcgccgagcacggccgg
caggcgcgtggctacccggacgtgcgggccaacacggtggcctcgttcgcgctcggcgac
tacgagtggatgctcgcgttcgaggccgacgagctgcaccggatcgtcgacctgatgcgt
gacctgcgggcctcccgggcgcgccggcacgtgcgcgaggaggtgccgttctacaccggc
cgtcgccgctcgatcagcgagatcgcggctagcctgccgtag

DBGET integrated database retrieval system