KEGG   Actinoplanes sp. SE50/110: ACPL_7086Help
Entry
ACPL_7086         CDS       T02044                                 

Gene name
hemE
Definition
(GenBank) uroporphyrinogen decarboxylase
  KO
K01599  uroporphyrinogen decarboxylase [EC:4.1.1.37]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase00860  Porphyrin and chlorophyll metabolism
ase01100  Metabolic pathways
ase01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ase00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ACPL_7086 (hemE)
Enzymes [BR:ase01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.37  uroporphyrinogen decarboxylase
     ACPL_7086 (hemE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: URO-D Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: AEV87966
UniProt: G8SFH5
Position
complement(7823547..7824665)
Genome map
AA seq 372 aa AA seqDB search
MEEEYADLRPGRPRRAAGRRSLTWHDDPVTVLDDSPFVRACRGLPGPHTPVWFMRQAGRS
LPEYRKLREGIGMLDSCRRPDLVTEITLQPVRRHRVDAAILYSDIVVPIAAAGVDLDIVP
GTGPVVAEPIRTAADLQRLRPITADDVDYVAEAVRLLVAELGATPLIGFAGAPFTLASYL
IEGGPSRTYLKTKAMMYAEPELWHALLARLAEITLAFLRIQIDAGVSAVQLFDSWAGALS
EADYREFVMPHSARVLRGLDDAGVPRIHFGVGTGVLLEAMGEAGADVVGVDWRTPLDVAS
KRLGPDKAVQGNLDPAILFAGWDVVEREARRVLAQGQSAPGHVFNLGHGVMPEMDPDILT
RLTALVHEASAR
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagagtatgccgatctccgcccgggccgccctcgccgcgccgccgggcgtcgc
tcactcacgtggcacgatgacccggtgacggttctcgacgattccccgttcgtccgcgcg
tgccgcgggctgcccggcccgcacacgccggtctggttcatgcggcaggccgggcgctcc
ctgccggagtaccggaagctgcgcgaggggatcggcatgctcgactcgtgccgccgcccc
gacctggtcaccgagatcaccctgcagccggtccgccggcaccgggtggacgccgccatc
ctgtacagcgacatcgtggtcccgatcgcggcggccggcgtcgatctggacatcgtgccc
ggcaccggcccggtggtcgccgagccgatccgcaccgccgccgacctgcagcggctgcgt
ccgatcaccgcggacgacgtggactacgtcgccgaggcggtccggctgctggtcgccgag
ctcggcgccaccccgctgatcggcttcgccggggcgccgttcacgctggccagctatctg
atcgagggcgggccgtcacggacctacctgaagaccaaggcgatgatgtacgccgagccc
gagctgtggcatgccctgctcgcccggctggccgagatcaccctcgccttcctgcgcatc
cagatcgacgccggggtgagcgcggtccagctgttcgactcgtgggccggcgcgctctcc
gaggccgactaccgcgagttcgtgatgccgcattcggcgcgggtgctgcgtggcctggac
gacgccggtgtgccccggatccacttcggtgtcggcaccggggtgctgctggaggcgatg
ggcgaggccggcgcggacgtggtcggcgtcgactggcgcaccccgctcgacgtggccagc
aagcgcctcggtccggacaaggccgtgcagggcaacctcgacccggcgatcctgttcgcc
ggctgggacgtcgtcgagcgcgaggcccgccgcgtcctcgcccagggccagtcggctccg
ggtcacgtgttcaacctcggccacggcgtcatgcccgagatggaccccgacatcctcacc
cgcctcaccgcgctcgtccacgaggcatccgcacgctga

DBGET integrated database retrieval system