KEGG   Actinoplanes sp. SE50/110: ACPL_7090Help
Entry
ACPL_7090         CDS       T02044                                 

Definition
(GenBank) acetyl-CoA acyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase00071  Fatty acid degradation
ase00280  Valine, leucine and isoleucine degradation
ase00281  Geraniol degradation
ase00362  Benzoate degradation
ase00592  alpha-Linolenic acid metabolism
ase01100  Metabolic pathways
ase01110  Biosynthesis of secondary metabolites
ase01120  Microbial metabolism in diverse environments
ase01130  Biosynthesis of antibiotics
ase01212  Fatty acid metabolism
Module
ase_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ase00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ACPL_7090
   00592 alpha-Linolenic acid metabolism
    ACPL_7090
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ACPL_7090
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    ACPL_7090
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ACPL_7090
   00642 Ethylbenzene degradation
    ACPL_7090
Enzymes [BR:ase01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     ACPL_7090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEV87970
UniProt: G8SGT0
Position
7828090..7829286
Genome map
AA seq 398 aa AA seqDB search
MPREVREVVFVDGVRTPFGKAGGMYAETRADDLVIRCIRELIKRNPQLPTDRVDEVAIAA
TTQTGDQGLTIGRTAALLAGLPKTVPGYAVDRMCAGAMTAVTNVAGGIAMGAYDIAVAGG
VEHMGRHPMGEGADPNPRILTEKLVDPSALVMGATAENLHDRLPHITKERTDLFALNSQL
KVAKAYANGKLQPDLVPVAIRSSELGWGLATVDEAPRETSLEKLATLKTPFRPHGRITAG
NAAGLNDGATAALLADEATARELGLPVAMRLVSYAYVGVEPEIMGYGPIPSTEKALKKAG
LTIDDIGLFELNEAFAVQVLALLDHYGIADDDPRVNPWGGAIAVGHPLASSGVRLMTQLA
RHFEEHPEVRYGMNAMCIGIGMGGTVIWENPNWEGFKK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgccccgtgaagtacgcgaggtcgtcttcgtcgacggcgtccgcaccccgttcggcaag
gcgggcggcatgtacgccgagacccgcgccgacgacctggtgatccgctgcatccgagag
ctgatcaagcggaatccccagctccccacggaccgggtggacgaggtcgcgatcgcggcc
accacccagaccggcgaccagggcctgaccatcggccggaccgccgccctgctggccgga
ctgcccaagacggttcccggctacgccgtcgaccggatgtgcgccggcgcgatgaccgcg
gtgaccaacgtcgccggcggcatcgcgatgggggcgtacgacatcgccgtcgccggtggt
gtcgagcacatgggccggcacccgatgggtgagggcgccgacccgaacccgcggatcctg
accgagaagctggtcgacccgtccgccctggtgatgggcgcgaccgcggagaacctgcac
gaccggctgccgcacatcaccaaggagcgcaccgacctcttcgcgctcaactcgcagctc
aaggtcgccaaggcgtacgccaacggcaagctgcagccggacctggtgccggtcgcgatc
cgctcgtccgaactgggctggggcctggccaccgtcgacgaggcgccgcgcgagacctcg
ctggagaaactcgccacgctgaagacgccgttccgcccgcacggccggatcaccgcgggc
aacgcggccggtctcaacgacggcgccaccgcggcgctgctggccgacgaggccaccgcc
cgcgagctcggcctgccggtcgcgatgcggctggtgtcgtacgcctacgtgggtgtcgag
ccggagatcatgggttacggcccgatcccgtcgaccgagaaggcgctgaagaaggccggc
ctcaccatcgacgacatcggcctgttcgagctgaacgaggccttcgccgtgcaggtgctg
gccctgctggaccactacggcatcgccgacgacgacccgcgggtcaacccgtggggcggc
gcgatcgccgtgggccacccgctcgcctcctccggcgtgcgcctgatgacccagctcgcc
cggcacttcgaggagcaccccgaggtccggtacggcatgaacgcgatgtgcatcggtatc
ggcatgggtggcaccgtgatctgggagaacccgaactgggaaggcttcaagaagtga

DBGET integrated database retrieval system