KEGG   Actinoplanes sp. SE50/110: ACPL_7096Help
Entry
ACPL_7096         CDS       T02044                                 

Definition
(GenBank) hypothetical protein
Organism
ase  Actinoplanes sp. SE50/110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ_2 PQQ
Motif
Other DBs
NCBI-ProteinID: AEV87976
UniProt: G8SGT6
Position
complement(7837456..7838805)
Genome map
AA seq 449 aa AA seqDB search
MALIDLDRVAPPGPPRAARPPIRAYRRGGLLLALVLLTVLGGAVPAAGICWRYLGAITSP
LAPDGPIELAGGRVYTVGTAGADPVVTAWSTDDPPRRLWSVRAPVGAGPGVVPPSSVTVR
PAGDVALLTAGVATTAVDAASGRIRWSSPIAVTVLAGSGIGVTVDRVFRAGTVYDQASGA
PGPLYFSATGEPHTEPPLRTDVRGLDLADGHTVWTVAPGGAVTVDQVPGPDPAVLITSSA
RLSLVSGRTGEPVRQADLPRLSGHGPAGGALLGDVALVSYQNPGRQVAYRARTLQRLWSR
PVPDLVADPADCQGVLCDGGHGNLRVLDPGTGQARWRTGEDVDLAIRAGYVLETDAASGE
PVRLTDPHTGATAVDLDGWSAPVAGAADAPLLLRRRDGHGGQAFAAVVPGHAAVRELGSA
GVRLGDCDADGHYLACRSPEGLRLWAYRI
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtggccctgatcgatctggaccgcgtcgccccgcccggcccgccgcgtgccgcgcgtccc
ccgatccgcgcctatcggcgtggcggcctcctgcttgccctggtcctgctcaccgtgctg
ggtggcgccgtgcccgcggccggcatctgctggcgctatctcggcgcgatcacctcgccg
ctcgccccggacgggccgatcgagctggccggcggccgggtgtacacggtgggcacggcc
ggcgctgatccggtggtgaccgcctggagcacggacgacccgccgcggcggctgtggagt
gtccgcgccccggtcggcgccggcccgggtgtggtcccgccgtcctcggtgaccgtccgt
ccggccggtgacgtcgcgctgctgaccgccggggtggccaccaccgcggtcgacgccgcc
tccggccggatccgctggtcgtcgccgatcgcggtgaccgtgctggccggcagcggcatc
ggcgtcacggtcgaccgggtgttccgcgccggcacggtgtacgaccaggcgtccggcgcc
ccgggcccgctctacttctcggcgaccggcgagccgcacaccgagccgccgctgcgcacc
gacgtccgcggcctggacctggccgacgggcacaccgtgtggacggtcgcgccgggcggc
gcggtgacggtcgaccaggtgcccgggccggacccggccgtgctgatcacctcgtcggcc
cggctcagcctggtctccgggcggaccggcgagccggtgcgccaggccgacctgccccgg
ttgtccgggcacgggccggccggtggcgcgctgctcggcgacgtcgccctggtcagctat
cagaacccgggccggcaggtggcgtaccgggcgcgcaccctgcagcggctctggtcgcgc
ccggtgccggatctggtcgccgacccggcggactgccagggggtgctctgcgacggcggg
cacggcaacctgcgggtgctcgatccgggcaccgggcaggcccgctggcggaccggggag
gacgtcgacctggcgatccgcgccgggtacgtgctggagaccgacgccgcctccggtgaa
ccggtccggctcaccgacccgcacaccggggcgaccgcggtcgatctggacggctggtcg
gcaccggtggccggggcggccgacgcgccgctgctgctgcgccgccgggacgggcacggc
gggcaggcgttcgccgccgtggtccccggccacgcggcggtccgcgagctgggctcggcc
ggggtccggctgggcgactgcgacgcggacgggcactatctggcctgccgctccccggag
ggactgcggctctgggcgtaccggatctga

DBGET integrated database retrieval system