KEGG   Actinoplanes sp. SE50/110: ACPL_7127Help
Entry
ACPL_7127         CDS       T02044                                 

Gene name
cheY
Definition
(GenBank) Transcriptional regulatory protein resD
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase02020  Two-component system
ase02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ase00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ACPL_7127 (cheY)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    ACPL_7127 (cheY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ase02022]
    ACPL_7127 (cheY)
   02035 Bacterial motility proteins [BR:ase02035]
    ACPL_7127 (cheY)
Two-component system [BR:ase02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   ACPL_7127 (cheY)
Bacterial motility proteins [BR:ase02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    ACPL_7127 (cheY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg
Motif
Other DBs
NCBI-ProteinID: AEV88007
UniProt: G8SGW7
Position
complement(7868625..7868996)
Genome map
AA seq 123 aa AA seqDB search
MTTVMLVDDSATMLMSLKSILTKAGYSVETAGHGKEALDKLGKGVKPNLIISDVNMPQMD
GITFAREARKAPGMRFTPILMLTTESDQAKRVEAKNAGATGWLVKPVGPDQLLGVIKQVL
PGA
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgtgatgctcgtcgacgactccgccaccatgctgatgagcctcaagtcgatc
ctgaccaaggccggatactcggtcgagacggccgggcacggcaaggaggcgctcgacaag
ctcggcaagggcgtcaagcccaacctgatcatcagcgacgtgaacatgccgcagatggac
gggatcaccttcgcccgtgaggcccggaaggctccgggtatgcggttcaccccgatcctc
atgctgaccaccgagtcggatcaggccaagcgggtcgaggcgaagaacgccggcgcgacc
ggctggctggtcaagccggtcggaccggaccagctgctgggcgtgatcaagcaggtgctg
cccggggcctga

DBGET integrated database retrieval system