KEGG   Actinoplanes sp. SE50/110: ACPL_7138Help
Entry
ACPL_7138         CDS       T02044                                 

Definition
(GenBank) Sporulation-control protein spo0M
  KO
K06377  sporulation-control protein
Organism
ase  Actinoplanes sp. SE50/110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spo0M
Motif
Other DBs
NCBI-ProteinID: AEV88018
UniProt: G8SGX8
Position
complement(7879022..7879792)
Genome map
AA seq 256 aa AA seqDB search
MLQALGVGGPSVDTVLTDPNCFPGGFLAGNVHIAGGDHAVDVEYVAVGLMTRVEVETGDN
EYQTNQEFHRQRLTGSFRLEPGARHDVPFRFEVPWQTPITELYGQHLHGMTMGLATELEV
ARAVDKSDLDAVQVHPLPAQERILEALLRLGFRFHKADVERGRVYGVEQELPFYQEIEFH
PPAQYASGINQLELTFLPTPRRLQVVLELDKRGGLFTEGHDAFGSFDVDYATVDRVDWTA
QLDDWLRQSARRRGLF
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaggcactcggggtgggcgggccgtccgtcgacaccgtgctgaccgatccgaac
tgctttcccggcggcttcctggcgggaaacgtccacatcgccggcggtgaccacgcggtc
gacgtggagtacgtcgcggtcggcctgatgacccgggtcgaggtggagaccggcgacaac
gagtaccagaccaatcaggagttccaccggcagcggctgaccggttcgttccggctggag
ccgggcgcccggcacgacgtgccgttccgcttcgaggtgccctggcagaccccgatcacc
gagctgtacggccagcatctgcacggcatgacgatgggcctggcgaccgagctggaggtg
gcccgggcggtggacaagtccgacctggacgcggtgcaggtgcacccgctacccgcccag
gaacggatcctggaggccctgctgcggctgggtttccgcttccacaaggccgacgtggaa
cggggccgggtctacggggtcgagcaggagctgccgttctaccaggagatcgagttccac
ccgccggcgcagtacgcgtccgggatcaatcagctggagctgaccttcctgcccacgccc
cggcgtctgcaggtggtgctggagctggacaagcgcggtggcctgttcaccgaggggcac
gacgccttcggcagcttcgacgtcgactacgccaccgtggaccgggtggactggaccgcg
cagctcgacgactggctgcggcagtccgcccgccgccgcgggttgttctag

DBGET integrated database retrieval system