KEGG   Actinoplanes sp. SE50/110: ACPL_7139Help
Entry
ACPL_7139         CDS       T02044                                 

Gene name
sigB
Definition
(GenBank) RNA polymerase principal sigma factor hrdB
  KO
K03087  RNA polymerase nonessential primary-like sigma factor
Organism
ase  Actinoplanes sp. SE50/110
Brite
KEGG Orthology (KO) [BR:ase00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ase03021]
    ACPL_7139 (sigB)
Transcription machinery [BR:ase03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     ACPL_7139 (sigB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r2 Sigma70_r3 Sigma70_r4 Sigma70_r1_2 HTH_28
Motif
Other DBs
NCBI-ProteinID: AEV88019
UniProt: G8SGX9
Position
7879998..7880987
Genome map
AA seq 329 aa AA seqDB search
MVLETKATVEDIMTDEVEQVVDLDATDERGVSADLVRAYLNGIGRTRLLTAVEEVTLSKR
IEAGLYAEEKLPAADAALAELLDIVIAEGRAAKNHLLEANLRLVVSIAKRYTGRGMAFLD
LIQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEQVNRM
VRARRDLSAQLGREPSIAEIATAMAVPEFQVIELISYDREPVSLDQAVGEDGESALGDFV
AAVDPNQPGEGVSQGELRSEVEIVLATLSERESAVIRLRFGLDDGRQRTLDEVGREFGLS
RERIRQIEKVTMLKLRDPERASRLEAYAV
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtggtcctggagacgaaggcgacggttgaggacatcatgaccgacgaagtcgagcaggtg
gtcgacctcgacgcgacggacgagcggggcgtctccgccgacctggtccgcgcctacctc
aacggcatcggccgcacccgcctgctgaccgcggtggaggaggtcaccctctccaagcgg
atcgaggccggcctctacgccgaggagaagctgccggccgcggacgccgcgctggccgag
ctgctggacatcgtgatcgccgagggccgggccgccaagaaccacctgctggaggcgaac
ctgcggctcgtggtcagcatcgccaagcgctacaccggacgcggcatggcgttcctggac
ctgatccaggagggcaacctcggcctgatccgcgccgtcgagaagttcgactacaccaag
ggctacaagttctcgacctacgcgacgtggtggatccggcaggcgatcacccgcgcgatg
gccgaccaggcccgcaccatccgcatcccggtgcacatggtcgagcaggtcaaccggatg
gtccgggcccgccgcgacctgtccgcccagctcggccgcgagcccagcatcgccgagatc
gccaccgcgatggcggtgccggaattccaggtcatcgaactcatctcgtacgaccgtgag
ccggtcagcctcgaccaggcggtcggtgaggacggcgagagcgcgctcggtgacttcgtc
gccgcggtcgacccgaaccagcccggcgagggcgtctcgcagggcgagttgcgcagcgag
gtggagatcgtgctggccaccctctccgagcgagagtccgcggtgatccggctgcgcttc
ggcctggacgacggccgccagcgcaccctcgacgaggtcggccgcgaattcggcctcagc
cgcgagcggatccgccagatcgagaaggtgaccatgctgaagctgcgcgacccggaacgg
gcctcccgcctcgaggcctacgcggtctga

DBGET integrated database retrieval system