KEGG   Actinoplanes sp. SE50/110: ACPL_7140Help
Entry
ACPL_7140         CDS       T02044                                 

Definition
(GenBank) CoA-binding domain protein
Organism
ase  Actinoplanes sp. SE50/110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_5 Succ_CoA_lig CoA_binding_2 Acetyltransf_3 Acetyltransf_1 CoA_binding Acetyltransf_4 CPSase_L_D2 Acetyltransf_7 Acetyltransf_10 Acetyltransf_CG FR47
Motif
Other DBs
NCBI-ProteinID: AEV88020
UniProt: G8SGY0
Position
complement(7881003..7883549)
Genome map
AA seq 848 aa AA seqDB search
MERSADVLLADGTAVHLRQIRPADAPAIVEFHSRMSDRTRYLRYFSPYPRIPERDLQRFV
NVDHRDREAFVTVAADGRITSVGRYERLGPDSPEAEVAFVVEDAQQGRGIGSVLLEHLAE
AARDHGITRFVAEVLPENGGMLRVFGDSGYSVQRRYADGVVHLGFPIAPTEKSREVQESR
EHLTESRSIARLIAPRGIAIYGASASGHGIGAAMLGNLRDGGFTGAVVPVHPTAPTVAGL
TAYRKASEAGAPIDLAVIAVPAERVAAALADAAAAGAGGVVVGSAGFAEAGPDGAARQRA
LIETAHAAGLRVIGPSSFGLANTDPAVRLNATMAPRLPAAGRVGFFAQSGALGVALLAEA
DRRGLGLSSFVSAGNRADVSGNDLLQYWRDDPGTDVVLLYLETFGNPRKFARLARRMSRE
KPVVAVASATRPPGLAGDLPGPDAHAVTALFARSGVIRVDTVQELFDVGMLLAHQPLPAG
RRVAVVGNSSALAALAEVACRAAGLTVAEGYPHDLSPMATAQDLADALADAAVDDRVDAL
VVVFAPLVPGQQLSEEDADFAAALGSVALAGEKPTVATLVFGRVPPRVPVYPSVEEAVRA
LTRVVNYAEWLRRPPGRMPALSGLDPAAAEAAESTTELLAAYGVEVVPSTLAGSEREAVA
AADALGYPVALKAAGGGLRHRIDLGAVRLAIQDEDDLCTSYRDLAAAFGPEVLVQTMVAP
GVACVVEVVEDPAFGPVVGFGLGGVASELLGDLAWRAAPLTDRAAEALVDEPRAAPLLHG
YRGSTPVDRAALIDLLLRVGRLADERPRIRSLLLNPVLARPDGFSVLHAAAEWGEPGVRP
DTGPRRLR
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcagcgcagacgtcctgctcgccgacggcaccgcggtgcacctgcggcagatc
cggccggccgacgcgccggcgatcgtggagttccactcccggatgagcgaccgcacccgg
tatctgcggtacttctcgccctatccgcggattccggaacgcgatctgcagcgcttcgtc
aacgtcgaccaccgggaccgcgaggcgttcgtcacggtcgccgcggacggccggatcacc
tcggtgggccgctacgagcggctcggcccggattcgccggaggccgaggtggcgttcgtg
gtggaggacgcccagcagggccgggggatcggctcggtgctgctggagcatctggccgag
gcggcccgggaccacgggatcacccggttcgtcgccgaggtgctcccggagaacggcggc
atgctgcgggtcttcggcgattccggctattcggtgcagcggcggtacgccgacggcgtg
gtgcacctgggtttcccgatcgcgcccaccgagaagtcgcgcgaggtgcaggagtcccgg
gagcatctgaccgagtcccggtcgatcgcccggctgatcgccccgcgcgggatcgccatc
tacggcgcgagcgccagcgggcacgggatcggcgccgcgatgctgggcaatctgcgcgac
ggcgggttcaccggcgcggtcgtcccggtgcatccgacggcgcccacggtggccgggctg
accgcgtaccggaaagcgtcggaggccggcgcaccgatcgacctggcggtgatcgcggtc
ccggccgagcgggtcgcggcggccctggccgacgcggcggcggcgggggcgggcggcgtg
gtggtcggcagcgccgggttcgccgaggccgggccggacggcgcggcccggcagcgggcg
ctgatcgagaccgcgcacgcggccggcctgcgggtgatcggcccgagcagtttcgggctg
gccaacaccgatccggcggtccggctgaacgcgaccatggcgccccggctgccggccgcc
ggtcgggtcggcttcttcgcccagagcggtgcgctcggggtggcgctgctggccgaggcg
gatcggcgcgggctgggcctgtcgagtttcgtctcggccggcaaccgcgccgacgtgtcc
ggcaacgatctgctgcagtactggcgggacgatccgggcaccgacgtggtgctgctctat
ctggagacgttcggcaacccgcgcaagttcgcccggctggcgcgccggatgagccgggag
aaaccggtggtcgcggtggcctcggcgacccgtccgccgggtctggccggcgatctgccg
gggccggacgcgcacgcggtgaccgcgctgttcgcccggtccggggtgattcgggtggac
accgtgcaggagcttttcgacgtcggcatgctgctggcccatcagccgttgccggccggg
cgccgggtggccgtggtcggcaactcgtcggcgctggcggcgctggccgaggtggcctgc
cgggcggccgggctgaccgtggccgagggctatccacacgatctgagcccgatggcgacc
gcgcaggacctggccgacgcgctggccgacgcggcggtcgacgaccgggtggacgcgctg
gtggtggttttcgcgccgctggtgcccggccagcagctgtctgaggaggacgcggatttc
gcggcggcgctgggcagtgtggcgctggccggggagaaaccgacggtggcgacgctggtc
ttcggccgggtgccgccgcgggttccggtctatccgtcggtcgaggaggcggtccgggcg
ctgacccgggtggtcaactacgccgagtggctgcgccgcccgccggggcggatgcccgcg
ctgtccgggctggatccggccgccgcggaggccgccgagagcacgacggagctgctcgcc
gcgtacggcgtcgaggtggtgccgtcgaccctggcgggttccgagcgggaggcggtcgcc
gccgcggacgcgctgggctatccggtcgcgctcaaggcggccggtggcggcttgcggcac
cggatcgacctcggcgcggtccgcttggccattcaggatgaggatgacctgtgtacgtcg
tatcgcgacctcgccgcggccttcggcccggaggtgctggtgcagaccatggtcgccccg
ggcgtcgcctgcgtcgtcgaggtggtcgaggacccggcgttcggcccggtggtcggtttc
ggtctcggcggggtggccagcgagctgctcggcgacctggcctggcgggccgccccgctg
accgaccgggccgcggaggcgctggtcgacgagccgcgcgcggccccgctgctgcacggt
taccgggggtccaccccggtcgaccgggccgctctgatcgacctgttgttgcgggtcggc
cggctcgccgacgagcgcccgcggatccggtcgttgctgctcaacccggtgctggcccgg
ccggacggcttctccgtgctgcacgccgcggcggaatggggcgagcccggcgtccgtccg
gacaccgggccgcgccgcctgcggtga

DBGET integrated database retrieval system