KEGG   Actinoplanes sp. SE50/110: ACPL_7145Help
Entry
ACPL_7145         CDS       T02044                                 

Definition
(GenBank) hydrolase
Organism
ase  Actinoplanes sp. SE50/110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4 Thioesterase Lipase_3 UPF0227
Motif
Other DBs
NCBI-ProteinID: AEV88025
UniProt: G8SGY5
Position
7886913..7887818
Genome map
AA seq 301 aa AA seqDB search
MINDSLVDAGGVQLAVRDFGGDHPPLLLLHGAGGNLAHMTLLARALRPHHRVVTVDLRGH
GRSADGPWTWDAALGDLAAVCVELELERPAIAGHSLGGMLATLWGQRHPESPGVVNLDGS
PPPTRPDQLPGLTPDRAAAELERLTGVFDMVEAAAGQTVEAGELADLVERQRMAARDRGA
NEKVWIEGFRRNLVHGKDGTTTFRPSFATTTQLRALMTELDLAPVHAATKCPSLLVLATR
DLPEQEPFADLYAAHRRYVLAQAEAIPHLRHVALADASHAMVIEQPEALATLITTFLAEA
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacgacagcctggtggacgcgggcggtgtgcagctcgcggttcgggacttcggg
ggcgaccatccgccactgctcctgctgcacggggccggcggcaacctcgcccacatgacc
ctcctcgcccgggcgttgcgcccgcaccaccgggtggtcaccgtcgatctgcgcgggcac
ggacggtccgcggacggtccgtggacctgggatgccgcgctcggcgacctggccgcggtc
tgcgtcgagctggagctggagcggccggcgatcgccggccattcgctcggcggcatgctg
gccacgctctggggtcagcggcacccggagtcccccggtgtggtgaatctggacggcagt
ccgccgcccacccgccccgaccagctgcccggcctcaccccggaccgggccgccgccgag
ctggagcggctcaccggcgtcttcgacatggtcgaggccgccgccggtcagaccgtcgaa
gccggcgaactggccgacctggtcgagcgccagcggatggcggcccgggaccgcggcgcc
aacgagaaggtgtggatcgagggtttccgccgcaacctggtccacggcaaggacggcacc
accaccttccggccgtccttcgccaccaccacccagctgcgcgccctgatgaccgagctg
gacctggccccggtccacgccgccaccaagtgcccgtcgctgctggttctggccacccgt
gacctgcccgagcaggagccgttcgccgacctgtacgcggcccaccgccgctacgtgctg
gcccaggccgaggccatcccccacctgcgccacgtcgcgctggccgacgcctcgcacgcc
atggtgatcgaacagcccgaggcgctcgccaccctgatcaccacctttctcgcggaggcc
cgctga

DBGET integrated database retrieval system