KEGG   Actinoplanes sp. SE50/110: ACPL_7157Help
Entry
ACPL_7157         CDS       T02044                                 

Definition
(GenBank) hypothetical protein
Organism
ase  Actinoplanes sp. SE50/110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF349 DUF1090
Motif
Other DBs
NCBI-ProteinID: AEV88037
UniProt: G8SGZ7
Position
7902557..7903768
Genome map
AA seq 403 aa AA seqDB search
MNEDWTAFGRVDADGTVYVKTAEGDRVVGSWQAGTPEEGLAHFARRFEDLVTEVDLVEAR
LKSGAADASHSLTSVKRLRTQLDEAHVVGDIDGLTARLEKLSALADEKASEAKAAREVAR
TEALARKTALVEEAEKIAADATGWKSAGDRLKEILDEWKTIRGVDKKTDGELWKRFAAAR
DGFTRRRGAHFATLDGQRKQAQTAKEELVTEAESLAASTEWSSTANRLKELMTEWKAAPR
AAKEAEQRLWERFRAAQDAFFTRRSEVFSARDAEYQGNLERKQAILAEIEAVDVDADPRG
AQNRLRDAQAAWHDAGRVPREAAAGLDRRWRAAEERIRVAMDSAWRKTSPQDNPLLRQMR
DQVAEAEQRLERARAAGDNRRIKEAEQALASKKQFLALAEQAN
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaggactggacggccttcggacgcgtggatgccgacggcaccgtgtacgtgaag
accgccgagggcgaccgggtggtcggctcatggcaggccgggacgccggaggagggcctc
gcccacttcgcccgtcgtttcgaggacctggtgaccgaggtcgacctcgtcgaggctcgc
ctcaagtcgggcgcggccgacgcgtcccactcactgaccagtgtcaagcggctgcgcacc
cagctcgacgaggcgcacgtggtcggcgacatcgacggtctcaccgcccggctggagaaa
ctttccgcgctggccgacgagaaggcgagcgaggccaaggccgcccgcgaggtcgcccgc
accgaggcgctggcccgcaagaccgccctggtcgaggaggcggagaagatcgccgccgac
gccaccgggtggaagtcggccggtgaccggctcaaggagatcctcgacgagtggaagacg
atccgcggcgtcgacaagaagaccgacggtgagctgtggaagcggttcgccgccgcccgg
gacggtttcacccggcgtcgtggcgcgcacttcgccaccctggacgggcagcgcaagcag
gcgcagaccgccaaggaggagctggtcaccgaggccgagtcgctggccgcttcgaccgag
tggtcgagcacggcgaaccggctgaaggagctgatgaccgagtggaaggccgcgccgcgc
gccgccaaggaggccgagcagcgcctctgggagcggttccgggccgcgcaggacgcgttc
ttcacccggcgcagtgaggtcttctccgcccgcgacgcggagtaccagggcaacctggag
cgcaagcaggcgatcctggccgagatcgaggcggtcgacgtggacgccgatccgcgcggc
gcgcagaaccggctccgcgacgcgcaggccgcgtggcacgacgccggccgggtgccgcgg
gaggccgcggccgggctggaccgccgctggcgggccgccgaggagcggatccgggtggcg
atggactcggcgtggcgcaagaccagcccgcaggacaacccgctgctgcgtcagatgcgc
gaccaggtcgccgaggccgagcagcggctggagcgggcccgggcggccggcgacaaccgg
cggatcaaggaggccgagcaggcgctcgcctcgaagaagcagttcctggcgctggccgag
caggccaactga

DBGET integrated database retrieval system