KEGG   Actinoplanes sp. SE50/110: ACPL_7160Help
Entry
ACPL_7160         CDS       T02044                                 

Gene name
ilvA
Definition
(GenBank) threonine dehydratase
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase00260  Glycine, serine and threonine metabolism
ase00290  Valine, leucine and isoleucine biosynthesis
ase01100  Metabolic pathways
ase01110  Biosynthesis of secondary metabolites
ase01130  Biosynthesis of antibiotics
ase01200  Carbon metabolism
ase01230  Biosynthesis of amino acids
Module
ase_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACPL_7160 (ilvA)
   00290 Valine, leucine and isoleucine biosynthesis
    ACPL_7160 (ilvA)
Enzymes [BR:ase01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     ACPL_7160 (ilvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PCMT
Motif
Other DBs
NCBI-ProteinID: AEV88040
UniProt: G8SH00
Position
complement(7906315..7907274)
Genome map
AA seq 319 aa AA seqDB search
MELTLADFRAAHAVVRRHLAPTPLGGYPLLDRAAGATVLVKHENAQPVGAFKVRGGLTLL
DALPAADRARGTLTWSTGNHAQSLAYASHRYGVPCTVVMPAGTDPGRAAAVEAWGARVVL
AGDRLEDAQEHAGKLAAETGALAVSPGDTPELLAGVGTLYLEILEREPDLDAIVVPVGSG
TGAAAACLVSAALGARCAVIGVQSAASPAAHDSWRAGELLARPNRSTVAGLATGRGYALP
QRVMRAGLADFLLVGDDEIGAARRLLASAAHTLAEGAGAAALAGVLSRPDLFAGRRIAVV
CSGGNADRAELGTMIDGRG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggagctgaccctcgccgacttccgcgccgcccacgccgtcgtccgccgccacctggcg
cccaccccgctcggcggctacccgctgctggaccgggcggccggcgcgaccgtgctggtc
aagcacgagaacgcgcagccggtcggcgcgttcaaggtgcgcggcggactgaccctgctg
gacgccctgccggccgccgaccgggcccgcgggacgctcacctggtcgaccgggaaccac
gcgcagtcgctggcctacgccagccaccggtacggcgtgccctgcacggtggtgatgccg
gccggcaccgatccgggccgggccgccgcggtcgaggcgtggggcgcccgcgtggtgctg
gccggcgaccgcctggaggacgcccaggagcacgccggcaagctggccgcggagaccggc
gcccttgcggtcagccccggggacacgcccgagctgctggccggggtcggcaccctgtac
ctggagattctggagcgggaaccggacctggacgcgatcgtggttccggtcggcagcggc
accggggcggccgcggcctgcctggtgagcgcggccctgggcgcgcgctgcgcggtgatc
ggcgtgcagtcggccgcctcaccggccgcacacgactcgtggcgggccggcgagttgctc
gcccggcccaaccggtccacggtggccggcctggccaccgggcgcggctacgcgctgccg
cagcgggtgatgcgggccggcctggccgatttcctgctggtcggtgacgacgagatcggg
gcggcccgacgactgctggcgagcgccgcgcacaccctggccgagggggccggcgcggcc
gcgctggccggggtgttgagccggcccgacctgttcgccgggcgccggatcgcggtggtc
tgcagtggaggcaacgccgaccgcgccgaactgggcacgatgatcgatggccgagggtga

DBGET integrated database retrieval system