KEGG   Actinoplanes sp. SE50/110: ACPL_7165Help
Entry
ACPL_7165         CDS       T02044                                 

Definition
(GenBank) hypothetical protein
Organism
ase  Actinoplanes sp. SE50/110
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEV88045
UniProt: G8SH05
Position
complement(7911263..7911715)
Genome map
AA seq 150 aa AA seqDB search
MTGMAGLWNWSAAGLIEPERVRNALAGALETPVGEIAGGGFGGLLCDVYQVGGDFPTLID
VFLAPGHLAEETIASAVAVRLGAALLLPDDTLNPTRYVLAEPDGTLRAVHVEEEETDDGV
ERRHARPCTGADPDCATGPGCARSRFRAAA
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgacgggtatggctggcctctggaactggtccgccgccgggctgatcgagcccgagcgc
gtgcggaacgccctggctggagcgttggaaaccccggtgggggagatcgccggggggggc
ttcggcggcctgctctgcgacgtttatcaggtcggtggcgattttccgacactgatcgat
gtattcctggccccgggccacctcgccgaggagacgatcgccagcgcggtcgcggttcgg
ctgggcgccgcgctgctgctgcccgacgacaccctcaacccgacccggtacgtgctggcc
gagccggacgggacgctgcgcgccgtgcacgtcgaggaggaggagaccgacgacggtgtc
gaacggcggcatgcccgcccgtgcaccggcgccgacccggactgcgccaccggcccgggt
tgcgcccgctcccggttccgggccgcggcctga

DBGET integrated database retrieval system