KEGG   Actinoplanes sp. SE50/110: ACPL_7173Help
Entry
ACPL_7173         CDS       T02044                                 

Definition
(GenBank) hypothetical protein
Organism
ase  Actinoplanes sp. SE50/110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3046
Motif
Other DBs
NCBI-ProteinID: AEV88053
UniProt: G8SI99
Position
complement(7921490..7921690)
Genome map
AA seq 66 aa AA seqDB search
MRLTDFWGRLEQAFGAAYARSIAADHAFAELDGRTIEQAIAQGVDTATIWRAVVASYPDR
VPSRLH
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
gtgcgactgacggacttctggggacgccttgaacaggcgttcggcgcggcctacgcccgc
agcatcgcggccgatcacgccttcgcggagctggacggccgcaccattgagcaggcgatt
gcgcagggtgtcgacacggctaccatctggcgcgccgtggtggcctcgtaccccgatcgg
gtgccttccaggctgcactga

DBGET integrated database retrieval system