KEGG   Actinoplanes sp. SE50/110: ACPL_7176Help
Entry
ACPL_7176         CDS       T02044                                 

Definition
(GenBank) uncharacterized protein
  KO
K07005  uncharacterized protein
Organism
ase  Actinoplanes sp. SE50/110
Brite
KEGG Orthology (KO) [BR:ase00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    ACPL_7176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridox_ox_2 Acetyltransf_3
Motif
Other DBs
NCBI-ProteinID: AEV88056
UniProt: G8SIA2
Position
7924710..7925951
Genome map
AA seq 413 aa AA seqDB search
MTEVYATTDRTTATRTRQRMHYERDRAHAILDEAYDCSVAFVADGEPRVLPTLHVRVGET
LYLHGSTGARLALGARGDGVPVCVSVTLLDGLVYGRSHFHHSANYRSVIAHGVARPVADP
AEKAAAMHALVEKVGAGRAAGSRPPTDREMAQTSVLALPLAEVSARVREGGVVDEPADLD
LPHWAGVLPIRRVAGPPESDAGVAVPPPAYLPGNPATEWQTPALMQGRLVRLEPLSPAHA
AGLFEALDDEEVWRHIPQQRASSVADMAEDVAEVIRGQWRGDRAGWAQVDPVTGVVMGMT
TYHDVDPDRRSVGIGHTMLGRRWWRTGVNTEAKLLLLERAFDVLGAAKVFWYTDIRNERS
QQAIARLGAGRDGLLRRQRLRPDGTWRDTVVFAMTADEWPAAARRLRDRLAAG
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggtctacgcgactaccgaccgcaccaccgcgacccggacccgccagcgcatg
cactacgagcgcgaccgggcacacgccattctggacgaggcgtatgactgttcggtggcc
ttcgtggccgacggcgagccacgcgtgctgccgaccctgcacgtccgcgtcggcgagacg
ctctatctgcacgggtccaccggcgcccggctggccctcggcgcccgcggtgacggcgtc
ccggtctgcgtcagcgtgaccctgctggacgggctggtctacgggcgctcgcatttccac
cacagcgccaactaccgttcggtgatcgcgcatggcgtcgcccgtccggtcgccgacccg
gcggagaaggcggcggccatgcacgccctggtggagaaggtgggcgccggccgggccgcg
ggcagccggccgccgaccgaccgggagatggcgcagaccagcgtgctcgcgctgccgctc
gccgaggtgtcggcccgggtcagggagggcggcgtggtcgacgagccggccgatctggac
ctgccgcactgggccggggtgctgccgatccgccgggtcgccggcccaccggagagcgac
gcgggcgtcgccgtgccgccgcccgcctacctgcccggcaacccggcgaccgagtggcag
accccggctctgatgcagggccggctggtccggctggagccgctgtcgccggcacacgcc
gcgggcctgttcgaggcactcgacgacgaggaggtctggcgccacatcccccaacagcgg
gcgagcagcgtggcggacatggccgaggacgtcgccgaggtgatccggggccagtggcgc
ggtgaccgggccggctgggcccaggtcgacccggtcaccggcgtggtgatgggcatgacg
acctaccacgacgtcgacccggaccgccgttcggtcgggatcggtcacaccatgctgggc
cgcaggtggtggcgcaccggggtgaacaccgaggccaaactcctgctgctggagcgggct
ttcgacgtgctcggcgcggccaaggtgttctggtacaccgatattcgcaacgagcgctcc
cagcaggcgatcgcccggctcggagccggtcgggacgggctgctccggcggcagcgtctg
cgacctgacggcacctggcgcgacaccgtagtcttcgcgatgacggcggacgagtggccg
gccgcggcgcggcgcctgcgggaccgcttggctgccggctga

DBGET integrated database retrieval system