KEGG   Actinoplanes sp. SE50/110: ACPL_7178Help
Entry
ACPL_7178         CDS       T02044                                 

Definition
(GenBank) Serine/threonine protein kinase
Organism
ase  Actinoplanes sp. SE50/110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like RIO1 Kdo
Motif
Other DBs
NCBI-ProteinID: AEV88058
UniProt: G8SIA4
Position
complement(7926813..7929119)
Genome map
AA seq 768 aa AA seqDB search
MAVRQMLVAGRYRLLEPVGAGGMGRVWLARDQMLDRDVAIKEIVPPDWMSEAEKDRLHSR
TLREARSAARLTHPHVVRVYDVLHDDGVSWIVMEYVASRSLYQVLITQGPYSPVEAARIG
LAVLDALNAAHRAGVLHRDVKPHNVLIGLDGRVLLTDFGLATFVDDGMVTTPGLIVGSPQ
YVSPERARDGASTVAADMWSFGATLYATVEGQSPYARDSAMATLAALATEPPNPPLRAGP
IGPILEGLLRYAPEDRLSADETERRLRAVLGETGPAAAARPATVVAPVTRMVAEDSPTVA
AVAPPSEAKTDSDRTEVVPVATGELVRTADLAGTGLVLEGESGPAEFPEEDEADHDDDAE
DSDGWWQSGRGYIDGTFTVTDDLDAGSVPAAAGHSHYGAGRWTDGGNRAPSSSGVPRAHH
NRQPSAAGRPAATRLLRRGNQATVRGIPSPRSPVSGPLPDTGVPPGRWALHPLPAKRIST
RAVLAGLLAVALISGSLLSVHLMQRDDSAPQMVHSPMPAPSGMSSSGMSPSDMSPSDMSP
SGMSSSGMPASGMSPSSRASAPEAGASQPRASPTGSVSPVTAGFSPIVCDAPAPHHAPVA
PQAGAGRGVDGWRLQAGWSYFTDGTGFHLPVPDGWTYQRIGSTYCFREPRGGRVLSLDVG
RPAATAPLQGCRAEDRRLRASRQVRDYRAMSLAPVVLLHAAVDWEFRYRTSGGVLRRART
RWLSMGGRAYALGWATPEAAWAAELGKLEMVWSTFYTDGGTPASASRG
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcaggcagatgctcgtcgcaggccggtaccgattgctggaaccggtcggcgca
ggtgggatgggacgggtctggctggcccgcgatcagatgttggaccgggacgtcgcgatc
aaggagatcgtcccgccggactggatgagcgaggcggagaaggaccgtctgcacagccgc
acgctgcgggaggcgcgcagcgcggcccggctgacgcatccgcacgtggtgcgggtgtac
gacgtgctgcacgacgacggggtgtcgtggatcgtcatggagtacgtggcgtcccggtcg
ctctaccaggtgttgatcacccaggggccgtactctccggtcgaggcggcccggatcggc
ctggccgtgctcgatgcgctgaacgccgcgcaccgcgccggggtgctgcaccgcgacgtg
aagccgcacaatgtcctgatcgggttggacggtcgtgtgctgctgaccgatttcggtctg
gccaccttcgtcgacgacggcatggtgaccacaccgggcctgatcgtcggctcaccgcag
tacgtctccccggaacgggcgcgggacggcgcctccacggtggcggcggacatgtggtcg
ttcggggcgacgctgtacgccacggtcgagggtcagtccccgtacgcccgggacagcgcc
atggcgacgcttgccgcgctggcgaccgaaccaccgaatccgccgctgcgggcgggtccg
atcggcccgatcctggaggggctgctccggtacgcgccggaggaccggctgtccgcggac
gagaccgagcgacggctgcgcgcggtgctcggggagaccgggccggccgccgcggcgagg
cccgcgaccgtggtcgcgccggtgaccaggatggtcgccgaggactcgccgacggtggcg
gccgttgcaccgccatccgaggcaaagaccgattcggatcgtacggaggtggtcccggtc
gctaccggcgaactggttcgcaccgcggatctggcggggaccgggctggtcctggaaggg
gagtcgggtcccgccgaatttcccgaggaggacgaggcggatcacgacgatgacgccgag
gactcggacggctggtggcagtccgggcgcggctacatcgacggcacgttcaccgtcacc
gacgatctcgatgccggctccgtcccggcggccgccggccactcgcactacggtgccggc
cggtggaccgacggggggaaccgggccccgagcagttccggcgtgccgcgcgcccaccac
aatcggcaaccctccgcggccgggcggccggcggccacccggttgctgcgccgtgggaac
caggcgacggtacgcggtatcccctcgccacgcagcccggtctccggcccgttgccggac
accggggtgccgcccggacgctgggcactgcatccgctgccggcgaaacggatctccacc
cgcgcggtgctcgccggtctgctggccgtcgctctgatcagcggcagcctgctcagcgtc
catctgatgcagcgggacgactccgccccgcagatggtgcattcgcccatgccggccccg
tcgggcatgtcgtcctccgggatgtccccatcggacatgtccccatcggacatgtccccg
tcgggcatgtcgtcgtccggcatgcccgcgtccgggatgtcaccgtcgagccgggcctcg
gcgcccgaggcgggcgcgtcacagccgcgggcatcgccgaccgggtccgtctcgccggtg
accgccggtttctcgccgatcgtctgcgacgcgccggcgccgcaccatgccccggtggcg
ccgcaggccggtgccggccgcggcgtcgacggctggcgcctgcaggccggctggtcgtac
ttcaccgacgggaccggattccaccttccggtcccggacggctggacctatcagcggatc
ggcagcacgtactgcttccgggagccgcgcggaggccgggtgctgagcctggacgtgggc
cggccggccgcgaccgccccgctccagggatgccgtgccgaggaccggcggctgcgggcg
agccggcaggtccgcgactaccgggcgatgtcgctggccccggtcgtcctgctgcacgcg
gcggtcgactgggagttccgttaccgcacctccggcggtgtgctgcggcgcgccaggacc
cgctggctgtcgatgggtggccgggcctacgccctcggctgggccaccccggaggccgcc
tgggccgccgaactgggcaagctcgaaatggtgtggagcaccttctacaccgacggcggc
accccggccagcgccagccgcggctga

DBGET integrated database retrieval system