KEGG   Actinoplanes sp. SE50/110: ACPL_7179Help
Entry
ACPL_7179         CDS       T02044                                 

Gene name
lhr
Definition
(GenBank) ATP-dependent helicase Lhr and Lhr-like helicase
  KO
K03724  ATP-dependent helicase Lhr and Lhr-like helicase [EC:3.6.4.-]
Organism
ase  Actinoplanes sp. SE50/110
Brite
Enzymes [BR:ase01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     ACPL_7179 (lhr)
DNA repair and recombination proteins [BR:ase03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   DNA helicases
    ACPL_7179 (lhr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD_assoc DEAD Helicase_C ResIII AAA_25 AAA_22
Motif
Other DBs
NCBI-ProteinID: AEV88059
UniProt: G8SIA5
Position
7929249..7934207
Genome map
AA seq 1652 aa AA seqDB search
MREVLENFGPATRAWFTAAFAAPTAAQDGAWRAIGAGRHALVVAPTGSGKTLAAFLWSLD
RLAREPVPEQVRRRCRVLYVSPLKALAVDVERNLRAPLTGIRQAAGRLGLPPPEITVGMR
TGDTPADERRGFARTPPDILITTPESLFLLLTSAARESLRGVETVIIDEVHAVAATKRGA
HLALSLERLDALLDRPAQRIGLSATVRPIEETARFLGGPQHVEIVRPPSTKTIDVTVQVP
VEDMTRLDESPAGDDLDGGRHTPSIWPAVEERVLDLIEGHRSTIVFTNSRRGAERLCARL
NELSAERVELARLGEQAAEHGEVPWRGGSGDPVGPPGAAPQARLDGPTAGAKAGLDELGA
GPPAGLDELGTGLPAGLDELGTGLPAGLDELGTGLPAGLDELGAGPSADSLGSGMPMGRG
GGRFRRTGKATSGTGNGPAPGGRPGGKPAGFRGNGAAGMPAAVMAQAGATLGAAPVVARA
HHGSVSREERKQIEEALKSGRLPAVVATSSLELGIDMGAVDLVVQIEAPPTVAAGLQRIG
RAGHQVGAVSRGVVFPKHRGDLLSCAVVAERMSEGAIEELRYPRNPLDVLAQQIVAMVAL
DAWPVDELAALIRRAAPFAELPESALHAVLDMLSGRYPSTAFAELRPRLVWDRGTDLLTG
RPGAQRLAVTSGGTIPDRGMFGVFLAGSEKASRVGELDEEMVYESRVGDVFLLGSTSWRI
EDITPDRVLVSPAPGAPARMPFWKGDSPGRPIELGRAIGARLRALVKAGDERATTALRES
GLDEWAAGNLVNYLREQRESTRHLPDDRTIVVERFRDELGDWRMTVHCVLGARVNAPWAL
AIGRRLGERFGVDGQVMPSDDGIVIRLPDTAEEPPGADLVAFDPEEILQIVEESVGTSAL
FASRFRECAARSLLLPRRDPRRRQPLWQQRQRSAQLLDVAREFADFPVTLEAARECLQDV
FDVPGLTGLMREIAGRKVRLVETETPRPSPFARSLLFGYVGAFLYEGDAPLAERRAAALA
LDATLLGELLGRVDLRELLDPGVVTETEAQLQWRTTQRSPRDAEDAAELLRLLGDLSPAE
LAERGVPEDWVVSLESARRAIRVRVAGEERWIGVDDAGRYRDALGVALPVGLAEAYLEPV
ADPLGDLVARYARTHGPFLAATCAARFGLGVFVVEQALKRLSATGRVTSGEFSPDGAGTE
WCDAEVLRMLRRRSLAALRREIEPVPPKVLAAFLPRWHQVGGNARGVDALAAVIEQVQGL
AVPASAWERLVLPARIADYAPPQLDELCGSGEVLWAGSGSIAGGDGWVTLAYADSAPLLL
PPPDEEFALTPAHQAVLDALGDGQALFFRSLSDRAGSTDDTDLAAVVWDLVWAGHLTNDT
FAPLRALLGGSGAHRAKAAPARSRYRRPGRPHLPSRTGPLNMAGRWSRLPDRDPDPTRRA
AALADLLLERHGVVTRGAVMAEGVTGGFAAVYPVLSALEERGAARRGYFVEGLGAAQFAV
PGAVDRLRALAEPAELAKRTGAGGLVLAASDPANPYGAALPWPERIVDSGDGEPVAKAGH
RAGRKAGALVVLVGGELVLYVERGGRTLLSFADDPEALTAAGQALAASVRSGALGAMSVE
RADGESVHASPLREALTAAGFRATPRGLRLRG
NT seq 4959 nt NT seq  +upstreamnt  +downstreamnt
gtgcgagaggtgcttgagaatttcggtccggccaccagggcgtggttcacggccgcgttc
gccgcgcccaccgctgcccaggacggcgcgtggcgggcgatcggcgccgggcggcacgcg
ctcgtggtcgcgcccaccggctccggcaagacgctggccgcgttcctctggtcactcgac
cggctggcccgggagccggtgcccgagcaggtgcggcgtcgctgccgggtgctctacgtc
agcccgctcaaggcgctggcggtcgacgtcgagcgcaacctgcgggcgccgctcaccggc
atccggcaggcggccggccggctcgggctgcccccgccggagatcaccgtcgggatgcgg
accggggacacgcccgccgacgagcggcgcggcttcgcccgtacgccaccggacatcctg
atcaccacacccgagtcgctgttcctgctgctcacctcggccgcccgggagtccctgcgc
ggcgtcgaaacggtgatcatcgacgaggtgcacgcggtcgcggccaccaagcgcggggcg
cacctggccctctccctggaacggctcgacgcgctgctggaccggcccgcgcagcggatc
gggctgtccgcgacggtgcgcccgatcgaggagaccgcgcggttcctcggcggcccgcag
cacgtggagatcgtccggccgcccagcaccaagaccatcgacgtcaccgtccaggtgccg
gtcgaggacatgacccggctggacgagtcacccgcgggcgacgacctcgacggcgggcgg
cacacgccgtcgatctggccggcggtcgaggagcgggtgctcgacctgatcgaggggcac
cggtcgacgatcgtcttcaccaactcccggcgcggggcggagcggttgtgcgcgcggctc
aacgagctctcggcggagcgggtggagctggcgcggctcggcgagcaggcggccgagcac
ggtgaggtcccgtggcgcggcgggtccggagaccccgtggggccgccgggagcagcgccg
caggcacggctcgacggacccacggcgggggcgaaggctgggctcgacgaactcggggca
ggcccgccggcgggactcgacgaactcgggacgggactaccggcaggactcgacgaactc
gggacgggactaccggcaggactcgacgaactcgggacaggactaccggcaggactcgac
gaactcggggcggggccgtcggcggactcgctgggctcggggatgccgatggggcgcggc
ggggggaggttccggcgtaccgggaaagcaacaagcgggaccggcaacggcccggcgccg
gggggaaggccgggcggaaagcccgccggtttccggggcaacggcgccgccgggatgccc
gcagcggtgatggcgcaggccggagcgaccctcggggcggcacccgtcgtcgcccgggcg
catcacggcagcgtttcgcgggaggaacgcaagcagatcgaggaggcgctgaaatccggg
cggctccccgccgtcgtcgccacctccagcctggagctgggcatcgacatgggcgcggtc
gacctggtggtgcagatcgaggcgccgccgaccgtcgcggccgggctgcagcgcatcggc
cgggccgggcaccaggtcggggccgtctcgcgcggggtggtctttcccaagcatcgcggt
gacctgctgtcctgcgccgtggtggcggaacggatgagtgagggggcgatcgaggagctg
cgctatccgcgcaatccgctcgacgtgctcgcccagcagatcgtcgccatggtggcgctc
gatgcctggccggtggacgagctggccgcactgatccggcgggccgcgccgttcgccgag
ctgcccgagtcggcgctgcacgcggtcctcgacatgctgtccgggcggtacccgtcgacc
gccttcgccgaattgcgcccgcggctcgtctgggaccggggcaccgacctgctcaccggt
cgccccggtgcgcagcggctcgccgtgaccagcggaggcaccatcccggaccggggcatg
ttcggcgtcttcctggccggctcggagaaagcctcccgggtcggcgagctcgacgaggag
atggtgtacgagtcccgggtcggcgacgtcttcctgctcggttccacctcgtggcggatc
gaggacatcaccccggaccgggtgctggtctccccggcgcccggcgccccggcccggatg
ccgttctggaaaggggactcccccggccggccgatcgagctgggccgggcgatcggtgcg
cggctgcgggcgctggtcaaggccggtgacgagcgcgccaccaccgcgctgcgcgagtcc
gggctggacgagtgggccgccggcaacctggtgaactacctgcgcgagcagcgcgagtcg
acccggcacctgcccgacgaccggacgatcgtcgtcgaacgtttccgcgacgagctgggc
gactggcggatgaccgtgcactgcgtgctgggcgcccgggtgaacgcgccgtgggccctg
gcgatcggccggcggctcggtgaacggttcggcgtcgacgggcaggtgatgccctccgac
gacggcatcgtgatccggttgccggacaccgccgaggagccgcccggcgccgacctggtc
gccttcgacccggaggagatcctccagatcgtcgaggagtcggtgggcacgtccgcgctg
ttcgcctcccggttccgcgagtgcgcggcgcggtcgctgctgctgccccgtcgggacccg
cgccgccggcagccgctctggcagcagcggcagcggtcggcgcaactgctcgacgtggcg
cgcgagttcgccgacttcccggtgacgctggaagcggcccgcgagtgcctgcaggacgtc
ttcgacgtccccggcctgaccggcctgatgcgcgagatcgccggccgcaaggtccgcctc
gtcgagaccgaaaccccgcggccgtcgccgttcgcgcgatcgctgctcttcggctacgtc
ggcgctttcctgtacgagggggacgcccccctggccgagcggcgcgccgccgcgctcgcc
ctggacgcgacgctgctcggcgagctgctcggccgggtcgacctgcgcgagctgctcgac
ccgggagtggtcaccgagaccgaggcccagctgcaatggcggaccacccagcgcagcccg
cgcgacgccgaggacgcggccgagctgctccggctcctcggcgacctctccccggccgag
ctggccgaacgcggcgtgccggaggactgggtggtgtcgctcgagtcggcccgccgggcg
atccgggtgcgggtggccggcgaggaacgctggatcggcgtcgacgacgcggggcggtat
cgggacgccctcggggtggccctgccggtcgggctggccgaggcgtacctggagccggtc
gccgacccgctcggtgacctggtcgcccgctacgcccgcacgcacggaccgttcctcgcg
gcgacctgcgcggcccggttcgggctcggcgtcttcgtggtggagcaggccctcaaacgg
ctgtccgcgaccggccgggtgacctccggcgaattctccccggacggcgccggcaccgaa
tggtgcgacgccgaggtgctgcgcatgctgcggcggcggtcgctggccgcgctgcgccgg
gagatcgaaccggtcccgccgaaggtgctggccgcgttcctgccccgctggcaccaggtg
ggcggcaacgcgcgcggtgtcgacgcgctggccgccgtcatcgaacaggtgcaggggctg
gccgtgccggcgtccgcgtgggagcggctggtcctgccggcccggatcgccgactacgcc
ccgccgcaactcgacgagttgtgcggcagcggcgaggtgctgtgggccgggtccgggtcg
atcgcgggtggcgacgggtgggtgaccctggcctacgcggactccgcgccgctgctgctc
cccccgccggacgaggagttcgcgctcaccccggcccaccaggcggtgctggacgcgctc
ggcgacgggcaggcgctgttcttccggtcgctgtccgaccgggccggctcgaccgacgac
accgacctggccgccgtcgtctgggatctggtgtgggccgggcatctgaccaacgacacg
ttcgccccactgcgcgcgttgctcggcggcagcggcgcgcaccgggcgaaagccgcgccg
gcccgaagccgctaccggcggcccgggcggccgcacctgccgtcccggaccgggccgctg
aacatggccggccgctggtcccggctgcccgaccgggaccccgacccgacccggcgggcc
gccgccctcgccgacctgctcctggaacgccacggggtggtgacccggggcgcggtgatg
gccgaaggggtgaccggtgggttcgcggcggtctacccggtgctgagcgcgctggaggaa
cgcggggcggcccgccgcggctacttcgtcgaggggctcggggccgcgcagttcgcggtg
cccggcgcggtggaccggctgcgggccctggccgagccggcggaactcgccaaacgcacc
ggggcgggcgggctggtgctggccgcgtcggatcccgccaacccgtacggggcggcgctg
ccctggccggaacggatcgtcgacagcggggacggtgagccggtcgccaaagccgggcac
cgggccggacgcaaggcgggggcgctcgtcgtgctggtcggcggcgagctcgtgctctac
gtggaacgcggcgggcggacgctgctgtcgttcgcggacgatccggaggcgctgaccgcg
gccgggcaggcgctggccgcctcggtgcggtccggggcgctcggggcgatgtcggtggaa
cgggcggacggagaatcggtgcatgcgtcgccgctgcgggaggcgctgaccgccgccggg
ttccgggctacgccgcgcgggttgcggctacgagggtga

DBGET integrated database retrieval system