KEGG   Actinoplanes sp. SE50/110: ACPL_7181Help
Entry
ACPL_7181         CDS       T02044                                 

Definition
(GenBank) uncharacterized protein
  KO
K22205  S-adenosyl-L-methionine hydrolase (adenosine-forming) [EC:3.13.1.8]
Organism
ase  Actinoplanes sp. SE50/110
Brite
KEGG Orthology (KO) [BR:ase00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ACPL_7181
Enzymes [BR:ase01000]
 3. Hydrolases
  3.13  Acting on carbon-sulfur bonds
   3.13.1  Acting on carbon-sulfur bonds (only sub-subclass identified to date)
    3.13.1.8  S-adenosyl-L-methionine hydrolase (adenosine-forming)
     ACPL_7181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SAM_adeno_trans
Motif
Other DBs
NCBI-ProteinID: AEV88061
UniProt: G8SIA7
Position
7935402..7936193
Genome map
AA seq 263 aa AA seqDB search
MAGYGWISFTTDYGTFDGFVAACHGSIARVAPDVRVIDVTHHVPPADVTRGAAVLAQTAP
HLPPSVHLAVVDPGVGTARRGVVLATPGGLLVGPDNGLLIWAAESLGGITAAHELGNKEW
TLGDVSRTFHGRDVFAPAAARLAGGAAPSEAGPALDPASLVRLPDPVASVGDGWIEAEVL
TVDRFGNVQLAAEGALLSGLGTELTVNGTVRARRGATFADVGAGELLVYTDSADQVAIAV
NNGRAVVVLSVVPGDMVRIAERR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggccggttacggatggatcagcttcaccacggattacggcacgttcgacgggttcgtg
gcggcctgccacggctcgatcgcccgggtcgccccggatgtccgggtgatcgacgtcacg
catcacgtgccgccggccgacgtgacccgaggtgccgccgtgctcgcccagaccgcgccg
catctgccgccgtcggtgcatctcgcggtggtcgacccgggggtcggcacggcgcgccgc
ggggtggtgctggccaccccgggcgggttgctcgtcggcccggacaacggcctgctgatc
tgggccgccgagtcgctcggcgggatcaccgcggcccacgagctgggcaacaaggagtgg
acgctgggcgacgtctcgcggaccttccacggccgggacgtgttcgctccggcggcggcg
cggctcgccggcggcgccgcgccgtccgaggccggtccggcgctcgacccggcttcgctg
gtccgtctgcccgatccggtcgccagcgtcggcgacggctggatcgaggcggaggtgctg
accgtcgaccggttcggcaacgtccagctggccgccgagggggcgctgctcagcgggctc
ggcaccgagctcaccgtgaacggcacggtccgggcccggcgcggggcgacgttcgccgat
gtcggggccggcgaattgctggtgtacaccgattcggccgaccaggtggcgatcgcggtg
aacaacggccgcgccgtcgtggtcctctcggtcgtccccggcgacatggtgcgcatcgcc
gaacgccgctga

DBGET integrated database retrieval system