KEGG   Actinoplanes sp. SE50/110: ACPL_7185Help
Entry
ACPL_7185         CDS       T02044                                 

Definition
(GenBank) XRE family transcriptional regulator
Organism
ase  Actinoplanes sp. SE50/110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_31 HTH_3 HTH_19 HTH_25 HTH_26
Motif
Other DBs
NCBI-ProteinID: AEV88065
UniProt: G8SIB1
Position
complement(7939508..7939906)
Genome map
AA seq 132 aa AA seqDB search
MVLLRRVIGDALRARRQGQHRTLREVSTAANVSLGYLSEIERGQKEASSELLAAICDALG
ARLSELLSEVSSTLSLAENMEGVLVPVDDKPGEPARQVATDGSVSVSVRQESPLKATLHA
TRNKKRDVVYAA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atggtcctgctacgccgggttatcggcgacgcacttcgtgcgcgccggcagggacagcac
cgcacgctgcgcgaggtgtcgaccgccgcgaacgtcagcctgggttatctgtccgagatc
gagcgtggtcagaaagaggcctccagcgagctgctcgcggccatctgcgacgcgctcggc
gcccgcctgtccgagttgctcagcgaggtcagcagcacgctgtcgctcgcggagaacatg
gagggcgtgctggtgccggtcgacgacaagccgggcgagccggcccgtcaggtggcgacc
gacggcagcgtgtcggtctcggtgcgccaggagtcgcccctgaaggcgacgctgcacgcc
acccgcaacaagaagcgggacgtggtctacgcggcttag

DBGET integrated database retrieval system