KEGG   Actinoplanes sp. SE50/110: ACPL_7630Help
Entry
ACPL_7630         CDS       T02044                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase00300  Lysine biosynthesis
ase01100  Metabolic pathways
ase01120  Microbial metabolism in diverse environments
ase01230  Biosynthesis of amino acids
Module
ase_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    ACPL_7630 (dapE)
Enzymes [BR:ase01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     ACPL_7630 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AEV88510
UniProt: G8S1P8
Position
complement(8435174..8436283)
Genome map
AA seq 369 aa AA seqDB search
MRPVLGTALYGAHMANPLTPDVLVDPVELTRALVDIASVSRDEKVIADCVQDVLREAGHL
TVDRVGNTVLARTDLGRAQRVVLAGHLDTVPINGNFPSTVVDDLIYGCGTADMKSGVAVA
LHLAATLPDPAYDVTYLFYEAEEIEHEFNGLNLVAAGKPEWLRADFAVLLEPTYGVVEAG
CQGTMRALVRTHGRRAHTARAWRGVNAIHAAGEVLRRLEAYHPRTVTIDGCTYREGLNAV
GITGGVAGNVVPDECAVEVNLRFAPDRSQAQALDHLNEVFAGFDLAVTDSAPGALPGLDA
TAAREFLTAVGVAPAAKLGWTDVARFAALGIPALNYGPGDPSLAHAPDEHVEIGQIRDSA
ATLHRWLAG
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtccggtgctcgggacggccttgtatggtgcgcacatggccaacccgctgaccccg
gacgtgctggtcgacccggtcgagttgacccgtgccctggtcgacatcgcctccgtgtcc
cgcgacgagaaggtgatcgccgactgcgtgcaggacgtgctgcgcgaggccggtcacctc
accgtggaccgcgtcggcaacaccgtgctggcccgcaccgacctgggtcgcgcgcagcgc
gtggtgctcgccggtcacctcgacacggtgccgatcaacggcaactttccgtccacagtc
gtcgacgacctcatctacggctgcgggacggcggacatgaaatccggggtggccgtggcg
ctgcacctggccgccacgctgcccgacccggcgtacgacgtgacctacctgttctacgag
gccgaggagatcgagcacgagttcaacgggctcaacctggtcgcggccggcaaaccggaa
tggctccgagccgacttcgcggtgctgctggaaccgacgtacggcgtggtcgaggccggc
tgccagggcaccatgcgggcgctggtgcgcacccacgggcgccgcgcacacaccgcccgg
gcctggcgcggggtgaacgcgatccacgcggccggcgaggtgctgcgccggctggaggcc
taccacccgcggaccgtgacgatcgacggctgcacgtaccgggaagggttgaacgccgtc
gggatcaccggcggcgtggccggcaacgtcgtccccgacgagtgcgcggtcgaggtcaac
ctgcggttcgcgccggaccggtcgcaagcacaggccctggaccacctcaacgaggtgttc
gccggcttcgacctggcggtcaccgactccgcccccggggcgctgcccggcctggacgcg
accgccgcccgggaattcctcaccgcggtcggggtggcgccggccgccaagctcggctgg
accgacgtggcccgcttcgcggcgctgggcatcccggcgctcaactacgggccgggcgat
ccgtcgctcgcccacgcgccggacgagcacgtcgagatcggccagatccgggacagcgcc
gcgaccctgcaccggtggctcgccggttag

DBGET integrated database retrieval system