KEGG   Actinoplanes sp. SE50/110: ACPL_787Help
Entry
ACPL_787          CDS       T02044                                 

Gene name
rplV
Definition
(GenBank) large subunit ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ase00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    ACPL_787 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ase03011]
    ACPL_787 (rplV)
Ribosome [BR:ase03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    ACPL_787 (rplV)
  Bacteria
    ACPL_787 (rplV)
  Archaea
    ACPL_787 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AEV81684
UniProt: G8SFX5
Position
778494..778952
Genome map
AA seq 152 aa AA seqDB search
MPAKGDAPVLPGARAVARHVRISPNKARRVVNLVRGLPAKEALTVLQFAPQAASEQVYKV
LASAVANAENNERLDPDALLVSEAFVDEGPTLKRFRPRAQGRAYRIRKRTSHITIAVEAV
QVARPAKKATAKKAAKPAEPQAAESQSTEGAE
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgccagcaaagggcgacgctccggtgcttccgggcgcgcgggcggttgcgcgacacgtg
cgcatctcgccgaacaaggcgcgccgggtggtcaacctcgtccgcggtctgcccgcgaag
gaggcgctgaccgtcctgcagttcgcgccgcaggccgccagcgagcaggtctacaaggtg
cttgccagcgccgtggcgaacgcggagaacaacgagcggctcgaccccgacgcactcctc
gtgagcgaggcgttcgtcgacgagggtcccacgctcaagcgtttccgtccgcgggcgcag
ggccgggcgtaccggatccgcaagcgtacgagtcacatcaccatcgcggtcgaggcggtc
caggtggcccgcccggcgaagaaggccacggcgaagaaggctgccaagccggctgagccg
caggctgccgagtcccagagcacggagggtgccgagtaa

DBGET integrated database retrieval system