KEGG   Actinoplanes sp. SE50/110: ACPL_7881Help
Entry
ACPL_7881         CDS       T02044                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase00010  Glycolysis / Gluconeogenesis
ase00260  Glycine, serine and threonine metabolism
ase00680  Methane metabolism
ase01100  Metabolic pathways
ase01110  Biosynthesis of secondary metabolites
ase01120  Microbial metabolism in diverse environments
ase01130  Biosynthesis of antibiotics
ase01200  Carbon metabolism
ase01230  Biosynthesis of amino acids
Module
ase_M00002  Glycolysis, core module involving three-carbon compounds
ase_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACPL_7881 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    ACPL_7881 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACPL_7881 (gpmA)
Enzymes [BR:ase01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ACPL_7881 (gpmA)
Membrane trafficking [BR:ase04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ACPL_7881 (gpmA)
Exosome [BR:ase04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ACPL_7881 (gpmA)
  Exosomal proteins of melanoma cells
   ACPL_7881 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEV88759
UniProt: G8S676
Position
complement(8693528..8694274)
Genome map
AA seq 248 aa AA seqDB search
MTGTLVLLRHGNSEWNAKNLFTGWVDVDLDAKGEDEARRGGELLKEQNVLPDVVHTSLLR
RAIRTSEIALHITDRHWIPVKRSWRLNERHYGALQGKDKKQTLDTYGEEQFMLWRRSYDV
PPPPIEDDSEFSQANDARYADLPPEIKPKAECLKDVLDRALPYWYDAIVPDLRAGKTVLV
AAHGNSLRAIVKHLDAISDEAIAKLNIPTGIPLRYDLDENLRPITAGGTYLDPQAAKEAA
AAVANQGR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgactggaaccctggtgctgttgcggcacggcaacagcgagtggaacgccaagaacctc
ttcaccggctgggtcgacgtggacctggacgccaagggcgaggatgaggcccggcgcggc
ggagagctgctcaaggaacagaatgtgctgcccgacgtcgtgcacaccagcctgctgcgg
cgtgccatccgcaccagcgagatcgccctgcacatcaccgaccggcactggatcccggtg
aagcggtcgtggcggctcaacgagcggcactacggcgctctgcagggcaaggacaagaag
cagaccctggacacctacggcgaggagcagttcatgctctggcgccggtcgtacgacgtg
cccccgccgccgatcgaggacgactcggagttctcccaggcgaacgacgcccgttacgcc
gacctcccgccggagatcaagccgaaggcggagtgcctgaaggacgtgctcgaccgcgcc
ctgccgtactggtacgacgcgatcgtcccggacctgcgggccggtaagacggtgctggtc
gccgcgcacggcaactcgctgcgcgcgatcgtcaagcacctggacgcgatctccgacgag
gcgatcgcgaagctgaacatcccgaccggcatcccgctgcgctacgacctggacgagaac
ctgcgcccgatcacggccggcgggacgtacctggacccgcaggcggccaaggaggccgcg
gccgcggtcgccaaccaggggcgctga

DBGET integrated database retrieval system