KEGG   Actinoplanes sp. SE50/110: ACPL_8240Help
Entry
ACPL_8240         CDS       T02044                                 

Definition
(GenBank) Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ase  Actinoplanes sp. SE50/110
Brite
Enzymes [BR:ase01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     ACPL_8240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 GCD14 Methyltransf_23 Methyltransf_11 Ubie_methyltran ACP_syn_III_C Methyltransf_3 Methyltransf_12 MTS Methyltransf_32 Fibrillarin Methyltransf_24 CMAS Methyltransf_16
Motif
Other DBs
NCBI-ProteinID: AEV89118
UniProt: G8SE13
Position
9077764..9078855
Genome map
AA seq 363 aa AA seqDB search
MTDLNEAFGAVPVLAYTDHERYGPTVHRSVPEWIQREVTSLRVQAGHRVLEIGTGSGYSG
ALLARLCGPRGRVTSIDISEELINRARAIHAERGVTEIDCHVADGLAGFPTAAPFDRAVG
WCTPPRLPRTWVEQITDGGRIVASLPIAPLPSTALITTITVDAGQPRVQAVVGGVYAQST
PAPVDDAVTVPGRWVDYCDRQPDPSWIAISWRTEDPHNSGARAALDRLLNPGHTETYGDM
EADWRSWSAHTAAPPDPGLSMVSLRNQIRGIGHTTATSAAVILTDGTIIADTPDSASLTV
LREWLILWQQAGRPTADSFIPRLVPNTSIDCPGGDLQLAVPADAVPASRAAIPQPRAGRV
EPA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacctcaatgaggctttcggtgccgtgcccgttctcgcctataccgatcacgag
cgctacggtccgaccgtccaccgctccgtgcctgagtggattcagcgtgaagtgacatcc
ctacgggtgcaggccgggcatcgcgttctggaaatcggcaccggctccggttacagcggc
gccctgctcgcccgcctgtgcggaccacgcgggcgagtcacgagcatcgacatcagcgag
gaactcatcaaccgggcgcgcgcgatccacgccgaacgcggagtcaccgagatcgactgt
cacgtcgccgacggcctggccggcttccccaccgccgcgccgttcgatcgggcggtcggg
tggtgcactccgccgcggcttccccggacctgggtcgagcagatcacggatggcggccgg
atcgtcgcctccctgccaatcgcaccgctaccgtccaccgccttgatcaccaccatcact
gtcgacgccgggcagccccgagtgcaggccgtcgtcggtggggtttacgcccagagcacc
ccggcgcccgtggacgacgccgtgaccgtgcccggccggtgggtcgactactgcgaccgc
caaccggatccgtcctggatagccatcagctggcgcaccgaagatccacacaacagcggc
gcccgcgcggccctcgaccggctcctcaaccccgggcacaccgaaacctacggcgacatg
gaggccgactggcggtcctggagcgcccacaccgccgccccgcccgaccccggtctgagc
atggtgtcgctgcgcaatcagatccgcgggatcggccacaccaccgccacatccgcagcc
gtgatcctgaccgacggcacgatcatcgccgacacaccggactcggcgtcgctaacggtc
ctacgcgagtggctaatcctctggcagcaggccggccgccccaccgccgacagcttcatt
ccccgactggtccccaacacgagcatcgactgccccggcggggacctacagctagccgtg
cccgctgacgcggtgccagcgtcgcgggccgctatcccgcagccgcgcgccggccgggtg
gagccggcatga

DBGET integrated database retrieval system