KEGG   Actinoplanes sp. SE50/110: ACPL_999Help
Entry
ACPL_999          CDS       T02044                                 

Gene name
argF
Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase00220  Arginine biosynthesis
ase01100  Metabolic pathways
ase01110  Biosynthesis of secondary metabolites
ase01130  Biosynthesis of antibiotics
ase01230  Biosynthesis of amino acids
Module
ase_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:ase00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    ACPL_999 (argF)
Enzymes [BR:ase01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     ACPL_999 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: AEV81896
UniProt: G8SJZ7
Position
complement(1003035..1004000)
Genome map
AA seq 321 aa AA seqDB search
MSTSEAFTGLPPRREPGGLLTLADLTPDRLAGLARRSVELYRDRTAHHDPLQGLLIGIVF
TRTSTRTRTAFTAGVERLGGRAIGYGPGDLQTNTGESLADTARMFGLMLDGIVTRTAGPL
ADMRLLSAESGLPVINAMAAEEHPTQGICDLATILLHRGSLDGARVLYVGEGNNTATALA
QGLSAFAGTELHLLTPDGYGLPEDALKAATARAAGNGGHVTESHDPRDVPAGAEFVYTTR
WQTTGTSKPDAAWRETFRPFHIDDQFLGRTPDALFLHDLPAHRGEEVSGAVLDGPRSVAW
SQARMKLCSAMAVLEYAFGRD
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtccacatcggaggccttcaccggcctgccgccgcggcgcgagccgggcggcctgctc
accctcgccgacctcaccccggaccggctggccggcctggcgcgccgctcggtcgagctg
taccgcgaccgcaccgcgcaccacgacccgctgcagggcctgctgatcggcatcgtcttc
acccgcacctccacccgcacccggaccgccttcaccgccggcgtcgaacggctcggcggc
cgggcgatcggctacgggccgggcgacctgcagaccaacaccggcgagtcgctggccgac
accgcccggatgttcggtctgatgctcgacgggatcgtcacccgcaccgccggcccgctc
gccgacatgcggctgctctccgccgagagcggtctgccggtgatcaacgcgatggccgcc
gaggagcaccccacccagggcatctgcgacctggccacgatcctgctgcaccgcggatcg
ctggacggggcccgggtgctctacgtcggcgagggcaacaacaccgcgaccgccctcgcg
cagggcctcagcgcgttcgccggcaccgagttgcacctgctcaccccggacggctacggg
ctgcccgaggacgccctgaaggcggccaccgcgcgggccgccggcaacggcggccacgtc
accgagtcgcacgatccgcgcgacgtgccggccggtgccgagttcgtctacaccacccgc
tggcagaccaccggcaccagcaagcccgacgcggcgtggcgggagaccttccggccgttc
cacatcgacgatcaatttctggggcgtacgccggatgccctcttcctgcacgacctgccc
gcccaccgtggcgaggaggtctccggcgcggtcctcgacggcccacgctcggtcgcctgg
tcacaggcgcggatgaagctgtgcagcgcgatggcggtgctcgagtacgcgttcggccgg
gactga

DBGET integrated database retrieval system