KEGG   Aggregatibacter segnis: NCTC10977_01803Help
Entry
NCTC10977_01803   CDS       T06075                                 

Gene name
nfsA
Definition
(GenBank) Oxygen-insensitive NADPH nitroreductase
  KO
K10678  nitroreductase [EC:1.-.-.-]
Organism
aseg  Aggregatibacter segnis
Pathway
aseg00633  Nitrotoluene degradation
aseg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aseg00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    NCTC10977_01803 (nfsA)
Enzymes [BR:aseg01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     NCTC10977_01803 (nfsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: SQH65233
Position
1:complement(1849857..1850591)
Genome map
AA seq 244 aa AA seqDB search
MSEKKLTSSTLDCILAHRSIRRFTDEPVSDKVIEQLVNAARFASTSNHLQCVSIVRITDP
AIRDQMMAYSSNQEYVKSAPEFWVFCVDFHKHKQICPTAQLDYAEVLLIGAVDTGIMSQN
VLLAAESLGLGGVYIGSLRNEMEAVGKLLNLPEHCLPMVGMCLGYPDQDPPTKPRLPKET
LFFENAYQPLDTTKLDEYNATVAEYYRQRSNIDMDWSRNVIKSLDKPIRPKVLAYLQQQG
FIKK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaaaaaactcacttcttcgactttagattgtattttagcccatcgttcaatt
cgtcgttttacggatgaacccgtatctgacaaggtgattgaacagcttgtaaatgcggcg
cgttttgcctctacatctaaccatttgcaatgtgtttctattgtgcgtatcactgatccg
gcgattcgtgatcaaatgatggcatacagttctaatcaggaatatgtgaaatccgcaccg
gagttttgggtgttctgtgttgatttccataaacataaacaaatttgtccaacagcgcag
ttagattatgcagaagtcttgctcatcggcgcagttgataccggtatcatgtcgcaaaat
gtattgttggcggcggaaagcctagggcttggcggtgtgtatattggttctttgcgtaat
gaaatggaagcggttggcaaattgttaaatctaccggaacattgtttaccgatggtgggg
atgtgtttggggtatcccgatcaggatccgccgaccaaaccacgcctgccgaaagaaacc
ttgttctttgaaaacgcctatcagccgttggataccactaaacttgacgaatataacgct
accgttgctgaatattatcgtcagcgtagcaacattgacatggattggtcacgtaatgtg
attaagagtttggataaaccgattcgcccgaaagtgttggcttatttgcaacaacaaggt
ttcattaaaaagtaa

DBGET integrated database retrieval system