KEGG   Candidatus Arthromitus sp. SFB-mouse-Japan: SFBM_0056Help
Entry
SFBM_0056         CDS       T01591                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
asf  Candidatus Arthromitus sp. SFB-mouse-Japan
Pathway
asf00040  Pentose and glucuronate interconversions
asf00052  Galactose metabolism
asf00500  Starch and sucrose metabolism
asf00520  Amino sugar and nucleotide sugar metabolism
asf01100  Metabolic pathways
asf01130  Biosynthesis of antibiotics
Module
asf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:asf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SFBM_0056 (galU)
   00052 Galactose metabolism
    SFBM_0056 (galU)
   00500 Starch and sucrose metabolism
    SFBM_0056 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SFBM_0056 (galU)
Enzymes [BR:asf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SFBM_0056 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: BAK55838
UniProt: F9VI80
Position
74124..74987
Genome map
AA seq 287 aa AA seqDB search
MSLIKKAVIPIAGFGTRFLPITKSVPKEMIPILDKPTIHYIVEEAVNSGITDILFVTSKH
KKCIEDYFDNFKELENVLELSGNYEMLNIIKDISNMANISFVRQKEQKGLGHAIYHAKAF
VGSDPFCVLLGDDLIYNDNKPCLKQLIDIHDDYGGSVIGVQKVDFKDVDKYGIIDGVEVY
KDLYEVKNLIEKPHVDHAPSNIAILGRYIISPSIFEFLEEGLVGKGGEIQLTDSILKLLT
NEKVYAYDFEGIRYDIGNKLGYLEATIDYALRDNSINRDLTRYLKER
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgtcactaataaaaaaagcggtaattccaatagcaggttttggtactagatttttacct
ataactaaatctgtacctaaggaaatgatacctattttagataaaccgactatacattat
attgtagaagaggcggttaattcaggtattacagatatattattcgttacgagtaaacat
aaaaaatgtattgaagattattttgataattttaaagaattggagaatgttttagagtta
tctggaaattatgaaatgttaaatataattaaagatatatctaatatggctaatataagt
tttgttagacaaaaggagcagaagggattaggtcatgcaatatatcatgctaaagctttt
gtgggttcagatccattttgtgtattacttggagatgatttaatttacaatgataataaa
ccttgtttgaaacaattgatagatatacatgatgattatgggggaagtgtgataggagtt
caaaaggttgattttaaagatgtagataagtatggtattattgatggtgtagaagtttat
aaggatttatatgaggttaaaaatttaattgaaaaacctcatgtagatcatgctccaagt
aacatagctattcttggtagatatataataagtcccagtatatttgagtttttagaggaa
ggtttggtaggtaaaggtggagaaatacaattgactgattctatattaaaattgcttaca
aatgaaaaggtatatgcttatgattttgaaggaattaggtatgatataggaaataagtta
ggatatttggaagcaacaattgattatgcattaagagataatagtataaatagagattta
acaaggtatttaaaagagaggtaa

DBGET integrated database retrieval system