KEGG   Candidatus Arthromitus sp. SFB-mouse-Japan: SFBM_0211Help
Entry
SFBM_0211         CDS       T01591                                 

Definition
(GenBank) mannitol dehydrogenase domain-containing protein
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
asf  Candidatus Arthromitus sp. SFB-mouse-Japan
Pathway
asf00051  Fructose and mannose metabolism
asf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SFBM_0211
Enzymes [BR:asf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     SFBM_0211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: BAK55990
UniProt: F9VJ30
Position
233456..234589
Genome map
AA seq 377 aa AA seqDB search
MKRAIQFGAGNIGRGFIGYLLSKSLYDVLFVDVNKDIIDKINENKRYRVVITDNVKSEEI
VENIRGMYSYDENLINEISNSNIITTAVGVSILPRISEIISKGIIKRIEDGNRSYLNIIA
CENSVNATDVLKNEILKYLSEDQKIQIENLVGFPNCSVDRIVPPCDIDSIDVNVEEFFEW
NVEKDKILGDLDINGMNKVCNLHSYIERKLFTLNTAHSMTAYLGFNKGYETIFESINDPY
IYKNVCDAMVESGEGLISKYSFDREEHMKYINKIINRFKNPYLVDSVLRVGREPMRKLSR
NDRFIKPILTSSSYGKDINALCLGVAYALKFITDKDENSLKMKSIIDEKGIRDAIVYICK
IDDEAIVDKIVKHYDNI
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagggcaatacaatttggtgcaggaaatataggaaggggatttattggatatctt
ttaagtaagtctttatatgatgttttatttgttgatgtaaataaagatataatagataaa
ataaatgaaaataaacggtatagagttgtaattacagataatgtaaagagtgaggagata
gtagaaaatatacggggtatgtattcttatgacgagaatctcataaatgaaatatctaat
tcaaatataataacaaccgcagttggtgtatcgattcttccaagaatatctgagattata
tcaaaaggtataataaaaagaattgaggatggaaatagatcatatttaaatataattgct
tgtgagaattctgtaaacgcaacagatgtcttaaaaaatgagattttaaaatatttaagt
gaagatcaaaagatccaaatagaaaatttagtaggctttccaaactgttccgttgatagg
attgttcctccatgcgatatagattctatagatgtaaatgttgaagaattctttgaatgg
aatgttgagaaagataaaatattgggtgatttagatataaatggcatgaataaagtatgt
aatttacattcgtatatagagagaaaattatttacgttaaatacagctcattcaatgact
gcttatcttggatttaataagggatatgaaacgatttttgagagtataaatgatccatat
atttataaaaatgtttgtgatgctatggttgagagtggagaaggtcttatatcaaaatac
tcttttgatagagaagagcatatgaaatatataaataaaataattaataggtttaagaat
ccatatttagttgattctgtcttgagggttggtagagagcctatgagaaaattatcaaga
aatgatagatttataaaacctatattaacatcaagtagttatggaaaagatataaatgca
ctatgtttgggagttgcatatgctcttaaatttataacagataaagatgagaatagtcta
aagatgaaatctataatagatgaaaaaggtataagggatgctatagtttatatttgtaaa
attgatgatgaggctatagtagataaaattgtaaaacattatgacaatatataa

DBGET integrated database retrieval system