KEGG   Candidatus Arthromitus sp. SFB-mouse-Japan: SFBM_0396Help
Entry
SFBM_0396         CDS       T01591                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
asf  Candidatus Arthromitus sp. SFB-mouse-Japan
Pathway
asf00030  Pentose phosphate pathway
asf00480  Glutathione metabolism
asf01100  Metabolic pathways
asf01110  Biosynthesis of secondary metabolites
asf01120  Microbial metabolism in diverse environments
asf01130  Biosynthesis of antibiotics
asf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:asf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SFBM_0396
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SFBM_0396
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:asf04147]
    SFBM_0396
Enzymes [BR:asf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     SFBM_0396
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     SFBM_0396
Exosome [BR:asf04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SFBM_0396
  Exosomal proteins of colorectal cancer cells
   SFBM_0396
  Exosomal proteins of bladder cancer cells
   SFBM_0396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: BAK56175
UniProt: F9VJ67
Position
429154..430635
Genome map
AA seq 493 aa AA seqDB search
MDQISINEPNIFVIFGATGDLTYRKLVPAIYNLYIQNLLPEKFNFVCIGRRDFSQEDYRN
NVKKSLGEFSKRTFTEENFKKFSGIFEYLKLDFVEDKEYRSLKDLIKSMCVKHGYNENIL
YYMAVSPEYFSIIVDRLRLNDLADSTRGIKRVIIEKPFGENLTSARELNEKMTKTFTEKE
IYRIDHYLGKEMSQNIMAIRFANPILEFIWNNRYIDNIQITSNESLGVLTRGKYYEKSGA
LKDMFQNHMLQLLTLIAMEPPVSLNTEDIRDEKVKVLKAMPKIDEKFVRENIVRGQYIED
SKGTLKGYRSEQDVSKDSMIETFVAIKCFINNYRWTGVPFYIRTGKRLSKKITEVVIEFK
NAPFVLYNEDNKLQPNLLVIRIQPDERIFLNLSVKKPGNENEIIPIQMDFCQNCHSLIST
EAYEKLMYDAIRGESTLFTRWDETEFSWKYVEKIFEIWDNNKDIPLYNYHSLSDGPCEIN
KLLHKENMKWWDI
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaataagtattaatgaaccaaatatttttgttatatttggagcaacgggagat
ttaacatatagaaaattagttccagcaatttataatttgtatatacaaaacttgttacct
gagaaatttaattttgtttgtatcggacgtagagatttttctcaagaagattatagaaat
aatgtaaagaaatctttaggagagttttcaaaaaggacatttacagaagaaaattttaaa
aaattttctggtatttttgagtatttgaaattagattttgttgaagataaggaatacaga
tctcttaaagatttgataaagagcatgtgtgtgaaacatgggtataatgaaaatatactt
tattatatggccgtatcccctgaatatttttctattatagtagatagattgagattaaat
gatttagctgatagtactagggggataaagagagttataattgaaaaaccttttggagag
aatttaacatctgctagagaattgaatgaaaagatgacaaagacttttacggagaaggaa
atttacagaattgatcattatttaggaaaagaaatgagtcaaaatataatggcaataaga
tttgcaaatccaatacttgaattcatatggaataatagatacattgacaacattcaaata
actagcaatgaatctttaggggttttaacgagagggaagtattatgaaaagtctggtgcc
cttaaagatatgtttcagaatcatatgcttcaattgttgacacttattgctatggaacca
cctgtgtctttgaatacagaggatataagggatgagaaggttaaggttcttaaagctatg
ccaaagattgatgaaaaatttgttagagaaaatattgttagaggtcaatatattgaagat
agtaaaggtactttaaagggatataggtcagagcaagatgtatccaaagattctatgatt
gaaacatttgttgctataaaatgttttattaataattataggtggacaggtgtccctttt
tatataagaacagggaaaagacttagcaagaaaataacagaggttgttattgagtttaag
aatgcgccatttgttttatataatgaagataataagttacaaccaaatcttcttgttata
aggatacaaccggatgaaagaatatttcttaatttgagtgtaaaaaaacctggaaatgaa
aatgagattataccgattcaaatggatttttgtcagaattgtcactctcttatttctaca
gaggcatatgaaaagctaatgtatgatgctataagaggagaatctactttgtttacaaga
tgggatgaaacagaattttcttggaagtacgttgagaaaatatttgagatatgggacaac
aataaggatattcctttatataattatcactctttgagtgatggaccttgtgaaataaat
aaattattgcataaagaaaatatgaaatggtgggatatttaa

DBGET integrated database retrieval system