KEGG   Candidatus Arthromitus sp. SFB-mouse-Japan: SFBM_1391Help
Entry
SFBM_1391         CDS       T01591                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
asf  Candidatus Arthromitus sp. SFB-mouse-Japan
Pathway
asf03010  Ribosome
Brite
KEGG Orthology (KO) [BR:asf00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SFBM_1391 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:asf03011]
    SFBM_1391 (rplV)
Ribosome [BR:asf03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SFBM_1391 (rplV)
  Bacteria
    SFBM_1391 (rplV)
  Archaea
    SFBM_1391 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: BAK57150
UniProt: F9VLZ2
Position
complement(1499983..1500321)
Genome map
AA seq 112 aa AA seqDB search
MDTKAIAKYVRMSPMKINVVLKLIRGKSIKEAYSILLYTNRRAAAVIEKVLKSAVSNAEN
NNNMDRNLLIVKSAYVNNGPILKRFQPRAQGRAFRINKRTSHITIIVGENSK
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggatacaaaagctatagccaaatatgtaagaatgtctcctatgaaaataaatgttgta
ttaaaactaataagaggcaaatcgattaaggaagcatattctattttgttatatacaaat
agaagagcggctgccgttatagaaaaagttttaaaatcagcagtttcaaatgcggaaaat
aataataatatggatcgaaatttattaattgttaagtctgcttatgttaataatggtcct
atattaaaaaggtttcaaccaagagctcagggtagagcatttagaattaataaaagaact
agccatattactataatagttggagaaaatagcaaataa

DBGET integrated database retrieval system