KEGG   Actinotignum schaalii: FB03_01575Help
Entry
FB03_01575        CDS       T03214                                 

Definition
(GenBank) crossover junction endodeoxyribonuclease RuvC
  KO
K01159  crossover junction endodeoxyribonuclease RuvC [EC:3.1.22.4]
Organism
asg  Actinotignum schaalii
Pathway
asg03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:asg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    FB03_01575
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:asg03400]
    FB03_01575
Enzymes [BR:asg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.4  crossover junction endodeoxyribonuclease
     FB03_01575
DNA repair and recombination proteins [BR:asg03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     FB03_01575
    RecFOR pathway proteins
     FB03_01575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvC
Motif
Other DBs
NCBI-ProteinID: AIE82175
UniProt: A0A068NHH6
Position
364252..364890
Genome map
AA seq 212 aa AA seqDB search
MRILGIDPGLTRCGLGTIDADVTRRVRLVDMRVARSPVDLAPHRRLLLIADEIDAVIAEF
SPEVVAVERVFAQENVRSVTSTAQVAGIAMLAAARAQLPLGLHSPSEVKAAVTGSGRAGK
LQVQNMVQRILGLAELPRPKDAADALAIAITHAWRGGAHALDATVDNGQHGGAGTLPRAE
GADLTPAQRMWAGAERMSRRAGAVSPHRSASG
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcattctggggattgacccgggactcacgcgctgcgggttgggaaccattgacgcc
gatgtgacgcggcgggtacgcctggtggatatgcgcgtggcgcgttccccggtggacctg
gccccgcatcggcgtctcctcctcatcgcggatgaaattgacgcggtgatcgcggaattt
tcccccgaagtcgtggcggtggaacgtgttttcgcgcaggaaaatgtgcgttcggtaacg
tccaccgcgcaggtggccggtatcgcgatgctggccgccgcccgcgcccagctgcccctc
ggcctgcattcaccctccgaagtgaaggcagcggtgacgggctcggggcgcgccgggaaa
ctccaggtgcaaaatatggtccagcggattttgggtttagcggaactgccgcgccccaag
gatgccgcggatgccctggccatcgcgattacccacgcctggcgcgggggcgcccacgcc
ctggacgccacggtggataacggccagcacggcggggccggcaccctcccgcgcgccgaa
ggagccgatttaacaccggcgcagcgcatgtgggcgggagccgaacgcatgagccggcgc
gccggggcggtttccccgcaccgctccgcaagcggttag

DBGET integrated database retrieval system