KEGG   Actinotignum schaalii: FB03_03260Help
Entry
FB03_03260        CDS       T03214                                 

Definition
(GenBank) metal-dependent phosphoesterase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
asg  Actinotignum schaalii
Brite
KEGG Orthology (KO) [BR:asg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FB03_03260
Enzymes [BR:asg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     FB03_03260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AIE82450
UniProt: A0A068NI84
Position
complement(737967..738806)
Genome map
AA seq 279 aa AA seqDB search
MAIDTHTHSTASDSTVTPRQLVEEAKSIGLTGIALTDHDTVAGWEEAAAAAASCAVVLIR
GMELSTKWEGITCHILGYLFDPHDGAIQEHIASTRASRLTRTRAIVDKLSADVPITWDDV
VAHTPPGATVGRPHIADALVAAGVVPTRSAAFTHYLSVHGPYYVSHYAPQACEAIRMVTA
AGGKAVLAHPVAPARNKVVPERAFEEMAAAGLFGVELHHPENDPALVPGLERIAARLQLR
GFGASDYHGRGKTNRLGQYTTSPDIIAELVDGTALPVLG
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggccatcgatacccacactcattccaccgcctccgattccacggtcactccgcgccag
ctcgtggaggaagccaagagtatcggcctgaccggaattgcgctcaccgaccacgatacg
gtggccggatgggaggaggccgccgctgcggcggcctcctgcgccgtcgtacttatccgt
ggcatggagttgtccacgaagtgggaagggatcacttgccatatcctcgggtatcttttc
gatccgcatgacggtgcgattcaggagcatattgcgagcacgcgggcgtcgcggctcacc
cgcacccgggccattgtggacaagctcagcgcggacgtgcctatcacctgggatgatgtt
gtggctcatacgcctccgggggcgactgtcgggcggccccatattgccgatgccctggtg
gcggccggcgtggttcccacccggagcgcggcttttacccactatctttccgtgcacggc
ccctactatgtgtcccattacgcgccgcaggcttgcgaggcaatccggatggtcacggcg
gcgggtgggaaagcggtgctggcccacccggtggcacccgcccgcaataaagtggtgccc
gagcgcgcctttgaggaaatggccgcggccgggctgttcggcgtggagctgcaccacccg
gaaaacgatccggcgctggtaccgggcctggaacgcatcgccgcgcgtttgcagctgcgc
ggtttcggagcgagtgattatcacgggcgcggaaaaacgaatcggctcgggcagtacacc
acgagcccggatattatcgccgaactggtcgacggtaccgcgttgcctgtgctaggttaa

DBGET integrated database retrieval system