KEGG   Actinotignum schaalii: FB03_05070Help
Entry
FB03_05070        CDS       T03214                                 

Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
asg  Actinotignum schaalii
Pathway
asg00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:asg00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    FB03_05070
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:asg01007]
    FB03_05070
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:asg03016]
    FB03_05070
Enzymes [BR:asg01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     FB03_05070
Amino acid related enzymes [BR:asg01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   FB03_05070
Transfer RNA biogenesis [BR:asg03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    FB03_05070
 Prokaryotic Type
    FB03_05070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1f DALR_2 tRNA-synt_1
Motif
Other DBs
NCBI-ProteinID: AIE82737
UniProt: A0A068NH04
Position
complement(1168216..1169760)
Genome map
AA seq 514 aa AA seqDB search
MSFKIYDSSARAVRDFVPLEPGKVSVYLCGATVQGSPHIGHIRSALAFDVLVRWLRRCGN
EVRLVRNVTDIDDKILDKSAQAGAPWWAWAYRFEKEFSAAYRTLGILDPTYEPRATGHIP
QMITLIQEIIDAGHAYVGKPGNVYFDVASLPDYGSLTRQKLENMVVDEEGGEADKRNPHD
FALWKAPKPGEPESAAWDTPWGRGRPGWHLECTAMSTHYLGKEFDIHGGGIDLRFPHHEN
EQAQAHAAGRNFARYWMHNAWVTVNGEKISKSLGNVISLEDVTAQVSPAVVRFALGTVHY
RSTVDYSPQNLAEAGAVWERLAGFVERAVAATEEVPAEEIAAVGPADLPEAFVRALDDDL
NVSSGLAAIHEEVRRGNAALAERDSAGVRAAQVRVRAMLDVLGLDPLAAPWRNSSGADKA
TARALGAVVDTMLEERAAARAAKDWARADALRDALHAAGIAVEDSVDGAHWHLENAQKPA
TAAKVPATGADAPASGTEKPTTATATPATGAEEK
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
gtgagcttcaagatctatgattcgtcagcccgtgccgtccgggatttcgttcccctggaa
cccgggaaggtcagtgtgtacctgtgcggcgctacggtgcaggggtccccgcatatcgga
catattcgctccgcactggccttcgatgtgctggtgcggtggctgcgccgctgcggcaat
gaggtgcgcctggtgcgtaacgtcaccgatattgacgataagatcctcgataaatcagcg
caggcaggtgccccgtggtgggcctgggcctaccgtttcgaaaaggaattcagcgctgcc
taccgcactctcggcatcctggatcccacgtacgagccgcgcgctaccgggcatatcccg
cagatgatcacgcttattcaggagattatcgacgccggccacgcctatgtgggcaagccc
ggcaatgtgtatttcgacgtcgcatcactacccgattacggttccctcacccgccaaaag
ctcgaaaatatggtggtggatgaggaaggcggggaagctgataagcgcaatccgcatgat
tttgcgctgtggaaggcccccaagccgggcgaaccggaaagcgcggcttgggatactccc
tgggggcgcgggcgcccgggctggcacctggagtgcaccgcgatgtccacccactacctg
ggcaaggaatttgatattcacggtggcgggatcgatttgcgcttcccgcaccatgaaaat
gagcaggcgcaggcccatgctgccgggcggaatttcgcgcggtactggatgcataacgcc
tgggtgaccgttaatggcgaaaaaataagtaagtcgctggggaatgtcatctctttggag
gatgttaccgcgcaggtatccccggcggtggtgcgtttcgcgctgggaacggtgcattac
cgctccacggtggattactcgccccaaaacttggcggaagccggggcggtgtgggagcgc
ctggccggcttcgtggaacgcgcggtggctgccactgaagaagtaccggcggaagaaatc
gcggcggtgggtccggctgatctgcccgaagcattcgtgcgggccctcgatgatgacctc
aatgtctcgagtgggctggccgcgatccatgaggaggtgcgccgcgggaacgccgcgctc
gcggagcgggacagcgccggagtgcgcgccgcccaggtgcgggtgcgggccatgctcgat
gtgctcggtctggatcccctggctgccccttggcgtaattccagtggggctgacaaagca
actgcgcgggcgctgggcgccgtcgtcgatactatgctggaggaacgcgcggccgcgcgc
gccgcgaaagactgggcccgggccgatgcgctccgcgatgctttgcacgcggccggcatc
gcggtggaagattcggtggacggcgcacactggcacctagaaaacgcgcaaaagcccgcc
accgcggcgaaagtgcccgccaccggcgcggacgctcccgcgtccggcacggaaaagccc
accaccgcaacagcaacgcccgccaccggcgcggaagaaaagtag

DBGET integrated database retrieval system