KEGG   Actinotignum schaalii: FB03_05210Help
Entry
FB03_05210        CDS       T03214                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
asg  Actinotignum schaalii
Pathway
asg00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:asg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    FB03_05210
Enzymes [BR:asg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     FB03_05210
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     FB03_05210
    1.1.1.-  
     FB03_05210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc FAD_binding_3 2-Hacid_dh_C AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AIE82760
UniProt: A0A068NJ45
Position
1203295..1204368
Genome map
AA seq 357 aa AA seqDB search
MKAIRYYGKEDVRLEDIPEPELRPGTVKISLAYNGICGSDLHLYFHGVMPPAPSADEPHP
ISGETLPVVFGHEFSGTVDEVGEGVTKVKAGDRVAVEPFMVCGECPACKKGMYNLCEKMG
FIGISGRGGGLAEKIVVEERWVHNVGDIPLDQAALIEPLSVGHHAVAHAGAAFGKAEGKV
AVVGGAGPIGLLTAAVLKAYGVKTIVSEPSEIRREKLKEVGVADLIVNPAEEDLLEKVKG
FTDGVLADFAFDCAGISAVADQLLSVLTTGGHLEVVALHVHPFELDLMGAIMMPERSISA
CIGYCNDHEPSIKLVQEGKVNLEPLITSKITADRIVEDGYKRLQGNPGEVKILVSMK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctattcgctactacggcaaggaagatgtccggcttgaggatattcccgaacct
gaactccggccgggaaccgtgaagatttccctggcgtacaacggtatttgtggctctgat
ctgcacctatatttccacggagtcatgccaccggctccctcggccgatgaaccacacccc
atttccggagaaactcttccggtggttttcggccacgaattctccggaactgtagatgaa
gttggcgaaggcgtcaccaaggttaaggccggtgaccgcgtcgctgtggaaccctttatg
gtgtgcggggaatgcccggcctgtaagaagggcatgtacaacctctgcgaaaagatggga
ttcattggaatctccgggcgcgggggtggcctggctgaaaagatcgtggtggaggaacgc
tgggttcataacgttggcgatattccgctcgatcaggccgcgctgatcgagccgctttcc
gttggccatcacgctgttgcgcatgccggcgcagctttcggcaaggctgaaggcaaggtt
gccgtggtgggcggagccggaccgattgggctgctcaccgctgcggtcctcaaggcttac
ggcgtgaagaccattgtgtccgaaccttccgaaattcgccgcgagaagctcaaggaagtg
ggggttgccgatctgatcgtcaatcccgcggaagaggatctgctggagaaggtgaaggga
tttaccgacggcgtgctcgcggacttcgctttcgattgcgccggaatttccgcggtggcc
gatcagcttctcagcgttctcaccaccggcgggcacctcgaagtggtggccctgcacgtc
catcccttcgagctggatctcatgggcgccattatgatgcccgagcgctccatcagcgca
tgcattggctactgcaatgatcacgaaccgtccatcaagctggtgcaggaaggcaaggtc
aatctggagccgctcatcacctcgaagatcaccgctgatcgcattgtcgaggatggctac
aagcgcctgcaaggcaacccgggcgaagtgaagattcttgtttcgatgaagtag

DBGET integrated database retrieval system