KEGG   Alistipes shahii: AL1_00590Help
Entry
AL1_00590         CDS       T02578                                 

Definition
(GenBank) 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ash  Alistipes shahii
Pathway
ash00500  Starch and sucrose metabolism
ash01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ash00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AL1_00590
Enzymes [BR:ash01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     AL1_00590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77 CBM_20
Motif
Other DBs
NCBI-ProteinID: CBK62792
UniProt: D4IIN4
Position
complement(84466..87069)
Genome map
AA seq 867 aa AA seqDB search
MTLLISIEYRTRWGEQLVLRLGKRRIALQYADGGVWTCAVERYAPAAQPAEYRYEVEREG
VCIRSEWRPHTLRIPSREGVRTLRIRDRWQEMPSDTPFYSSAFTRGIFGRGKTGNPKKAA
GNITLRVILPTLRPDETLAVAGSGRELGDWKRIVPMDDSRFPEWELTLHTAHRFEYKFLI
ADRKTLTPILWEEGANRTWGELPGAGEHALDAAAYPRFPERRWQGAGTAIPVFSLRTEED
FGVGEFYDLKRLIDWAAATGQCVIQVLPINDTTMTGTWEDSYPYNANSTFALHPQFIRLP
AAGVVEDDEYRTLRNELNALPEIDYERVNRHKLRLLRRAFERHGTRTAARRDYKDFIAAN
RHWLIPYAAFCTLRDETGTPDFTRWGGFARYDRKTVDAYCRSHNRDIAFHCYVQYHLHTQ
LSEVCAYARAHGIVLKGDLPIGISRTSVDAWLYPHLFHMDSQAGAPPDAFSAVGQNWGFP
TYNWERMARDGYAWWRARMAKMAEYFDAFRIDHILGFFRIWEIPTHAVHGLLGYFNPALP
YSADELRGMGFDTQDGRYTTPAPDEHMLGELFGDLAGEVRATCMKEGRLLPAYATQRKVA
ARFPGDDERQTRLREGLMALLDDVLFIEDPRRKGYFHPRIAPHSTHAYRRLDGERRAAFD
RLYTDFFYHRHNRFWQESALRKLPVLLSATEMLTCGEDLGMIPDSVPETMHELQILSLEI
QRMPKTPGELFADPAHYPYFSVCTTSTHDMNPLRAWWEEDRELTARFYHEALGIGGDVPY
FCEPWICRRILDMHLNSPAMLTILPLQDWFSTDGELRYPDPAKERINVPAVARYYWRYRM
HLPLEELLHKETFNESLHDMIACSGRR
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgacactcctgatcagcatcgaataccgtacccgctggggcgaacagctcgtactccgc
ctcggcaagcggcgcatcgccctgcaatacgccgacggcggcgtctggacctgcgccgta
gagcggtacgcccctgcggcgcagccggcagaataccgttacgaagtcgagcgcgagggc
gtgtgcatccgcagcgaatggcggccgcacacgctgcggatcccgtcccgggagggggtg
cgtacgctgcgcattcgcgaccgctggcaggagatgccctccgacacgccgttctactcc
tcggcattcacccggggcatcttcggccgcgggaaaaccggtaatccgaagaaagcagcc
ggcaacatcaccctgcgcgtcatcctgcccaccctgcggccggacgaaacgctcgccgtc
gccggcagcggccgtgaactgggcgactggaaacgaatcgtcccgatggacgacagccgc
ttcccggaatgggaactcacgctacataccgcacaccggttcgaatacaaattcctgatc
gccgaccgcaagaccctcacccccatcctgtgggaggagggtgccaaccgcacctggggc
gaactgcccggcgccggcgaacacgccctcgacgccgcggcgtacccgcggttccccgaa
cgcagatggcagggcgccgggacggcgatcccggtcttctcgctccgtacggaagaggat
ttcggcgtcggtgagttctacgacctgaaacggctcatcgactgggcggccgccaccggg
cagtgcgtcatccaggtactgccgatcaacgataccaccatgaccggtacatgggaagac
tcctacccctacaacgccaattcgaccttcgccctgcacccgcagttcatccggctgccg
gccgcgggcgtcgtggaggacgacgagtaccgcaccctgcgcaacgaactgaacgcactc
cccgaaatagactacgaacgggtcaaccggcacaaactgcggctgctccgccgggcgttc
gaacgccacggaacccgcactgcggcacgccgcgactacaaggacttcatcgccgccaat
agacactggctcatcccctatgccgccttctgcacgctgcgcgacgaaacgggcacgccc
gacttcacccgctggggcggcttcgcccgctatgaccgcaaaaccgtcgacgcctactgc
cgcagccacaaccgcgacatcgcattccactgctatgttcaataccacctgcatacgcag
ttgtccgaggtctgcgcctacgcccgcgcccacggcatcgtcctcaagggcgacctgccc
atcggcatcagtcgcacgagtgtcgacgcatggctctacccacacctgttccacatggac
tcgcaggccggggctccgcccgacgcattctcggccgtcgggcagaactggggattcccg
acttacaactgggaacgcatggcacgcgacggctacgcctggtggcgggcacgcatggcc
aagatggccgaatacttcgacgccttccgcatcgaccatatcctcggcttcttccgcatc
tgggagattcccacgcatgccgtacacgggttgctgggctatttcaaccccgccctgccc
tattccgcagatgaactgcgcggcatgggcttcgacacgcaggacggacgctacaccacc
ccggcgcccgacgaacacatgctcggggaactgttcggcgacctggccggcgaagtccgc
gccacctgcatgaaggaggggcggttactgcccgcctatgccacccagcgcaaggtcgca
gcccgcttcccgggcgacgacgaacgccagacccggctgcgggaagggctcatggcattg
ctcgacgacgtgctcttcatcgaagacccgcgccgcaagggctatttccacccccgcatc
gccccccactcgacgcacgcctaccgccggctcgacggagagcgccgtgcagctttcgac
cggctctataccgacttcttctaccaccggcacaaccgtttctggcaggaatccgccctg
cgcaagctcccggtgctcctctcggcgaccgagatgctgacctgcggcgaagacctgggc
atgattcccgacagcgtccccgagacgatgcacgaactgcaaatcctctcgctcgaaatc
cagcgcatgcccaagacgccgggggaactcttcgccgacccggcgcactacccctatttc
tcggtctgcaccacttcgacgcacgacatgaacccgctgcgggcatggtgggaggaagac
cgcgaactcacggcgcgcttctaccacgaagcactcggcatcgggggcgacgttccctat
ttctgcgagccgtggatatgccggcgcatcctcgacatgcacctcaattccccggcgatg
ctcaccatcctgccgttgcaggactggttctcgaccgacggggaactgcgctaccccgac
ccggccaaggaacgcatcaacgtcccggccgtcgcccgatactactggcgttaccgaatg
cacctcccgctcgaggaactgctgcacaaggagactttcaacgagtcgctgcacgacatg
atcgcctgcagcgggcgccgctga

DBGET integrated database retrieval system