KEGG   Alistipes shahii: AL1_04250Help
Entry
AL1_04250         CDS       T02578                                 

Definition
(GenBank) Pyruvate/oxaloacetate carboxyltransferase
  KO
K01960  pyruvate carboxylase subunit B [EC:6.4.1.1]
Organism
ash  Alistipes shahii
Pathway
ash00020  Citrate cycle (TCA cycle)
ash00620  Pyruvate metabolism
ash01100  Metabolic pathways
ash01120  Microbial metabolism in diverse environments
ash01200  Carbon metabolism
ash01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ash00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AL1_04250
   00620 Pyruvate metabolism
    AL1_04250
Enzymes [BR:ash01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     AL1_04250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA Biotin_lipoyl HMGL-like Biotin_lipoyl_2 HlyD_3 HlyD_D23 RnfC_N GCV_H NQRA
Motif
Other DBs
NCBI-ProteinID: CBK63075
UniProt: D4IJG3
Position
complement(475936..477723)
Genome map
AA seq 595 aa AA seqDB search
MNQEQIDRCLPFYKDANFYAMEVWGGAVPDSVMRYLDENPWTRLETIHKAVGDVSKLTAL
SRGRNLFGYSPYTDEIIDGFCRNSIRSGLGIMRIFDALNDVDNVKSTVKYVKQYGGIADC
AVCYTVDPKYPEPGFWARLTGKSAPKPVFTDAYFLDKARQMAALGADMITIKDMSGLIPP
RRVATLVRLLKKNLSVPVDFHTHCTPGYGLASVLSAIIAGVDVVDTNCWYFAEGTGAPAI
ELIHVFCKKLGIETGVNMEAVAKINTQLRDIRKELNQSVFGVEKPEPKAFNPVTDTLPAE
IDALFDRAIAAAQHDDENATIDACRKIEAYFGFPAPNELVQKAEIPGGMYSNMVAQLKQL
KAEEILPRAMELIPSVRLAAGLPPLVTPTSQIVGAQAVNCALDEKAGRPMYTNKSSQFVG
LVKGEYGKTPVKIDPEFRFKICGVREETPYDTSKYQMQPNPELPEAGGVKLAADEKEVLL
LELFPLVAKTFLTNMKVKAYEASKPAEPAAKAGETPAGETQAVITGNVVTAPLPGRIIEL
KVKVGDAVKAGQEVAVLEAMKMENAITSDFAGTVKQILVRQGQTVATDAVLMEIE
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaggagcagatcgaccgctgcctgccgttctacaaagatgccaatttctatgcg
atggaggtgtggggcggcgccgtccccgactcggtgatgcgttatctcgacgagaatccg
tggacgcgcctcgaaaccatccacaaggcagtgggcgatgtctcgaaactcacggccctt
tcgcgcggccgcaacctgttcggctactcgccctatacggacgaaatcatcgacggcttc
tgccgcaactcgatccggagcggtttgggcatcatgcggatcttcgacgccctgaacgac
gtcgacaacgtgaaatcgaccgtcaaatacgtcaagcagtacggcggcatcgccgactgt
gcggtttgctacaccgtggacccgaaataccccgaaccgggtttctgggccaggctgacg
ggcaaatcggcccccaaaccggtcttcaccgacgcctatttcctcgacaaggcccgccag
atggccgcactgggcgccgacatgatcaccatcaaggacatgtcgggtctgattccgccg
cgccgcgtcgccacgctggtgcgcctgctgaagaagaacctttcggttcccgtcgatttc
catacccactgcacgccgggctacggactggcttcggtgctttcggccatcatcgccggg
gtcgacgtcgtggacaccaactgctggtacttcgccgaaggcacgggcgccccggccatc
gagctgatccatgttttctgcaagaagctgggcatcgaaacgggcgtgaacatggaggcc
gtggccaagatcaacacccagctgcgggacatccgcaaggagctgaaccagtcggtcttc
ggcgtcgagaaacccgagccgaaggcgttcaacccggtgaccgacacgcttcccgccgag
atcgacgccctgttcgaccgggcgatcgccgcggcgcagcacgacgacgagaacgccacg
atcgacgcctgccgcaagatcgaggcctatttcggcttcccggctccgaacgaactggtg
cagaaggccgagattcccggcggcatgtattcgaacatggtggcccagctcaagcagctc
aaggccgaggagatcctgccccgcgccatggagctgatcccttcggtgcgcctggccgcg
ggtctgccgccgctggtgacccccacctcgcagatcgtgggtgcgcaggccgtcaactgc
gccctcgacgagaaggccggacgtccgatgtacaccaacaagtcgtcgcagttcgtgggc
ctcgtgaagggcgagtacggcaagacgccggtgaagatcgaccccgagttccggttcaag
atctgcggcgtgcgcgaggagactccctacgacacctcgaaataccagatgcagcccaat
cccgagcttcccgaagccggaggcgtgaagctcgccgccgatgaaaaggaggtgctgctg
ctggagttgttcccgctggtcgccaagacgttcctgaccaatatgaaggtgaaggcctac
gaggcttcgaagccggccgaacctgccgccaaggccggggagacgcccgccggagagacg
caggccgtgatcacgggcaacgtcgtgacggctccgctgccgggccgcatcatcgaactc
aaagtgaaggtcggcgacgcggtgaaggccggacaggaggtcgccgttctcgaagcgatg
aagatggagaacgccatcacgagcgatttcgccggtacggtcaagcagattctggtccgt
caggggcagaccgtggctaccgacgccgttctgatggagatcgaataa

DBGET integrated database retrieval system