KEGG   Actinobacillus suis H91-0380: ASU2_01855Help
Entry
ASU2_01855        CDS       T02262                                 

Definition
(GenBank) coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
asi  Actinobacillus suis H91-0380
Pathway
asi00860  Porphyrin and chlorophyll metabolism
asi01100  Metabolic pathways
asi01110  Biosynthesis of secondary metabolites
Module
asi_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:asi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ASU2_01855
Enzymes [BR:asi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     ASU2_01855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: AFU18513
UniProt: K0G2Y9
Position
409306..410673
Genome map
AA seq 455 aa AA seqDB search
MSEIIWDLALIQKYNQSGPRYTSYPTALEFSESYTDDDFKAAAERYPNRPLSLYVHIPFC
HKLCYFCACNKIITRHQHKVDIYLDYLEKEIKTRAPLFTNRTVTQIHWGGGTPTYLDEAQ
SERLMAMLRKHFNVSDDAEISIEMDPREIELDMLDHLRRIGFNRISMGIQDFNKEVQKLV
NREQDEEFIFALMKRAKELGFTSTNIDLIYGLPKQNVESFMYTLERVIELNPDRMSVFNY
AHLPSRFAAQIKIKDDMLPPPETKLTILQKTIEFLGDNGYKFIGMDHFAKPDDELAIAQQ
QGVLHRNFQGYTTQEECDLLGMGVSAISLLGDTYAQNHKELQQYYANVEEGGIALHKGLA
LSKDDGIRRDVIKALICNFKLEFDRLQAEYQIDFKKYFAEDLALLEPLAKDGLLEITENS
IVVSPRGRLLIRNICLCFDVYSRQLAKRQQFSRII
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaattatttgggatttagcccttatccaaaaatataaccaatccggtcctcgt
tatacgtcgtatccaacggcgttagagtttagtgaaagctacactgatgatgattttaaa
gcggcagcagaacgctacccgaatcgtccgttatcactttatgtgcatatcccattctgc
cataaattatgctatttctgtgcgtgtaataaaattattactcgtcatcagcataaagta
gatatttatttggactatcttgaaaaagaaattaaaacgcgtgctccacttttcacaaat
cgtacggtaacgcaaattcactggggcggtggtacgccaacgtatttggatgaagcacaa
tccgagcgtttaatggcgatgctacgcaagcattttaacgtgagcgatgatgctgaaatc
agtattgaaatggatccgcgtgaaattgaattggatatgttagatcatttgcgtcgcatt
ggatttaaccgtatcagtatggggattcaagatttcaacaaagaagtacaaaaattggta
aatcgtgagcaagacgaagaattcatttttgctttaatgaaacgtgcgaaagagcttggt
ttcacttccaccaatattgatttgatttacggtttaccaaaacaaaatgtcgaaagcttt
atgtacacgcttgagcgtgttattgagctgaacccagatcgtatgagtgtgtttaactat
gcgcatttgccaagtcgctttgccgcgcaaatcaaaattaaagacgatatgttaccgcct
ccggaaaccaaattaacgattctacaaaaaacgatcgagtttttaggtgataacggctat
aaattcattggtatggatcactttgctaaaccggatgatgagcttgccattgcgcagcag
cagggtgtgttacaccgtaatttccaaggttatactactcaagaagaatgcgatttgtta
ggcatgggtgtctctgcgattagcttacttggcgatacttacgcacaaaatcataaagaa
ttacaacaatattacgcaaacgtagaagaaggtggtattgcgttacataaaggcttggca
ttaagtaaagatgacggcattcgccgtgacgtgatcaaagcactgatttgcaactttaag
ttggaattcgaccgcttgcaggctgaatatcagattgattttaaaaagtattttgccgaa
gacttagcgctacttgagccattagcaaaagacggtttattagaaattaccgaaaacagc
attgtggtttcgcctagaggccgcttgctaattcgtaatatttgtttatgttttgacgta
tattcaagacagcttgcgaaaagacagcaattctcaagaattatttaa

DBGET integrated database retrieval system