KEGG   Actinobacillus suis H91-0380: ASU2_02140Help
Entry
ASU2_02140        CDS       T02262                                 

Definition
(GenBank) 3-deoxy-D-manno-octulosonic-acid kinase
  KO
K11211  3-deoxy-D-manno-octulosonic acid kinase [EC:2.7.1.166]
Organism
asi  Actinobacillus suis H91-0380
Pathway
asi00540  Lipopolysaccharide biosynthesis
Brite
KEGG Orthology (KO) [BR:asi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    ASU2_02140
Enzymes [BR:asi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.166  3-deoxy-D-manno-octulosonic acid kinase
     ASU2_02140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Kdo RIO1 APH Pkinase YrbL-PhoP_reg Choline_kinase
Motif
Other DBs
NCBI-ProteinID: AFU18570
UniProt: K0GA71
Position
complement(471363..472067)
Genome map
AA seq 234 aa AA seqDB search
MIFYHFNAKLVPHTQIETLKTLLNCKNFADSDRLLGSSKGRGITWFLNTQAELGVNVVLR
HYYRGGLFGKIVKDQYLFNGLENTRAFQEFSLLEKLHEWHLPVPRPVALKVEKNCCWYRA
DIMLEKIEGTQDLSKYLQTHTLSDTQYQQIGKLIRQLHDHQVHHSDLNIHNILLEPTSGQ
FFLIDFDKCGISQTNDWKSENLARLLRSFKKEQTRLNIRFNEQNWQALLAGYHK
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgattttttaccactttaatgccaaacttgtccctcacacacaaatagaaacactaaaa
acgttacttaattgcaaaaattttgctgattctgaccgcttgttaggttcatccaaaggc
agaggcattacttggtttctaaacactcaagccgaattgggtgtaaatgtggtgcttcgt
cattactatcgaggtgggctattcggcaaaatcgtcaaagatcagtatctatttaatggg
ttggaaaacacccgagcgtttcaagaattttccttattggaaaaattgcacgaatggcat
ttacccgtcccccgccctgttgcattaaaagtagaaaaaaactgttgttggtatcgtgct
gacatcatgctggaaaaaattgaagggacgcaagatttgagtaaatatctccaaactcac
acactttccgacacgcaatatcagcaaatcggtaaactgattcgccaattacacgatcat
caagtgcatcattcggatttaaatatccataatattttgcttgagccaacaagcggtcaa
tttttcttaattgatttcgataaatgtggcatttcacaaactaatgattggaaatcggaa
aacttagcccgcttactacgttcgtttaaaaaggagcaaactcgtttaaatattcgattt
aacgagcaaaattggcaagccttgctcgcgggttaccataaataa

DBGET integrated database retrieval system