KEGG   Actinobacillus suis H91-0380: ASU2_03110Help
Entry
ASU2_03110        CDS       T02262                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase dihydrolipoyltransacetylase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
asi  Actinobacillus suis H91-0380
Pathway
asi00010  Glycolysis / Gluconeogenesis
asi00020  Citrate cycle (TCA cycle)
asi00620  Pyruvate metabolism
asi01100  Metabolic pathways
asi01110  Biosynthesis of secondary metabolites
asi01120  Microbial metabolism in diverse environments
asi01130  Biosynthesis of antibiotics
asi01200  Carbon metabolism
Module
asi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:asi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASU2_03110 (aceF)
   00020 Citrate cycle (TCA cycle)
    ASU2_03110 (aceF)
   00620 Pyruvate metabolism
    ASU2_03110 (aceF)
Enzymes [BR:asi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ASU2_03110 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 HlyD_3 Ribosomal_60s NQRA
Motif
Other DBs
NCBI-ProteinID: AFU18762
UniProt: K0FWI7
Position
666848..668740
Genome map
AA seq 630 aa AA seqDB search
MSKQINVPDIGSDEVSVTEVMVKVGDTITVDQSLINVEGDKASMEVPAPEAGVVKEVLVK
VGDKVTTGSPMLVLEAAEAAPAPAAEAPAQAAAPVAVASAVVEVNVPDIGSDEVNVTEIM
VKVGDSVEVDQSIINVEGDKASMEVPAPIAGVVKEILINVGDKVSTGKLIMKFETASAAP
VAVEAPAQAAAPAATASAIKEVNVPDIGGDEVNVTEIMVNVGDTVSEEQSLITVEGDKAS
MEVPAPFAGVVKEILVKSGDKVSTGSLIMKFEVQGAAPAAAPAPAAQAAAPAAQAATQSA
QGGNVSGLSQDAVVAAGAYAHATPVIRRLAREFGVNLDKVKGSGRKGRIVKEDIQAYVKT
AVKAFETGTVAAAAGNGVANGAGLGLLPWPKVDFSKFGEVEEVELSRINKISGANLHRNW
VMIPHVTHFDRTDITELEAFRKEQNKIVEKQKLDVKITPVVFIMKAVAKALEAYPRFNSS
ISEDGQKLTIKKYINIGVAVDTPNGLVVPVFKNVNKKGIIELSRELMEVSKKARDGKLSG
SDMQGGCFTISSLGGIGTTHFTPIVNAPEVAILGVSKSEMAPVWNGKEFEPRLMLPLSLS
FDHRVIDGADGARFLSYINGVLADIRRLVM
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaacaaattaatgtgccagacatcggttcagatgaagtttctgtaactgaagtc
atggtaaaagtaggcgatactattactgtagatcaatcactcatcaacgtagaaggtgac
aaagcttcaatggaagtaccagcgccggaagcaggtgttgttaaagaagttttagtaaaa
gtgggcgataaagtaacaactggttcaccaatgttagtattagaagcggcagaagctgcg
ccagcaccagccgcagaagcgcctgcacaagctgcggcacctgtagcagtggcatcagca
gttgttgaagtgaatgtaccagatatcggctcagacgaagtaaacgtaaccgaaattatg
gttaaagttggtgattcagttgaagttgatcaatctatcatcaatgtagaaggtgataaa
gcttctatggaagttccagcacctatcgcgggcgttgtaaaagaaattttaatcaatgta
ggcgataaagtttcaaccggcaaattaattatgaaatttgaaactgcatcagcagcaccg
gttgctgtagaagcgccagcacaagcagctgcaccggcagcaacagcttcagcaattaaa
gaagtgaacgtacctgatatcggcggtgatgaagtaaacgtaactgaaatcatggtaaat
gttggtgatacagtatctgaagagcaatctttaattactgttgaaggtgacaaagcttca
atggaagttccggcaccatttgcaggtgttgtgaaagaaattttagtgaaatctggtgat
aaagtgtcaaccggttcattaatcatgaaatttgaagttcaaggtgcagcaccggcagca
gctcctgctcctgcagcacaagcagctgcaccagcggcacaagcagcaacgcaatcagct
caaggcggtaacgtttctggtttaagccaagatgcagtagtagcggcaggtgcttatgca
cacgcgacaccggtaattcgtcgtttagcacgtgaattcggtgtgaacttagataaagtg
aaaggttcaggtcgtaaaggtcgtattgttaaagaagatatccaagcatacgttaaaact
gcagttaaagcgtttgaaacaggtactgttgcagcggcagcaggtaacggtgttgcaaac
ggtgcaggtttaggcttattaccatggccgaaagtagacttcagcaaattcggtgaagtt
gaagaagtagaattaagccgtatcaataagatttctggtgcgaacttacaccgtaactgg
gtaatgattcctcacgttacacacttcgatcgtacagatatcacagaattagaagcattc
cgtaaagaacagaacaagattgttgaaaaacaaaaacttgatgtgaagatcacaccagtt
gtgttcattatgaaagcggttgcgaaagcattagaagcatacccacgtttcaatagctca
atttctgaagacggtcaaaaattaacaattaagaaatacatcaacattggtgttgcggtt
gatacaccaaacggcttagttgttccagtgttcaaaaatgtgaacaagaaaggtatcatc
gaactttcacgtgagttaatggaagtgtctaagaaagcgcgtgacggtaaactttcaggt
tctgatatgcaaggtggttgtttcactatttcaagccttggcggtatcggtacaactcac
ttcacaccaatcgtgaacgctccagaagttgcaattttaggtgtatctaagtctgaaatg
gcaccggtatggaatggtaaagagttcgagccacgcttaatgcttccactttcattatca
ttcgaccaccgtgtaattgatggtgctgatggtgcgagattcttaagctacatcaatggt
gtattagcagacattcgtcgcttagttatgtaa

DBGET integrated database retrieval system