KEGG   Actinobacillus suis H91-0380: ASU2_03485Help
Entry
ASU2_03485        CDS       T02262                                 

Definition
(GenBank) putative phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
asi  Actinobacillus suis H91-0380
Brite
KEGG Orthology (KO) [BR:asi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    ASU2_03485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AFU18837
UniProt: K0FWQ3
Position
complement(738572..739834)
Genome map
AA seq 420 aa AA seqDB search
MELLQEYGSTLVIITALFGFFMAFGIGANDVSNAMGTSVGSGTITARQAIIIAMVFEFAG
AYLAGGEVTETIKSGIIDVSLFADKPDVLVLGMMSALFAAGFWLLIASKMGWPVSTTHAI
IGAIIGFGCLTVGSEAVQWGQLGGIVGSWFITPVIAGIVAYWIFTSTQKLIFDTAEPMKN
AQKYGPFYMALTAFILSIVTMTKGLKHVGLHLTTTETVLISSAIAAVAVVACYFYFRSEA
FAKRAQGAAFGGVEKVFSILMLLTACSMAFAHGSNDVANAVGPLSAVVSIVESGGMVSGK
AALAPWILPLGAAGIAAGMLIMGYKVMGTMGTGITDLTPSRGFSAEFACATTVVIASGTG
LPISTTQTIVGAILGVGFARGIAALNLGIIRNIVASWVITLPAGAIIAIVIYEILLAIFY
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggaattacttcaagaatatggctctacgttagtcattattactgccctttttggtttt
tttatggcttttggtatcggtgccaatgacgtatctaatgcaatgggtacgtctgtaggt
tcaggtacgatcactgcacgccaagcaattattattgcaatggtctttgaatttgccggt
gcttaccttgccggcggtgaggtaaccgaaacaattaaaagcggtattattgacgtttca
ctttttgccgataagccggatgttttagtattaggtatgatgtctgcgctttttgctgcc
ggtttttggttattaatcgcatcaaaaatgggttggccggtatctactacccatgcaatc
atcggtgcaattatcggtttcggttgcttaaccgtaggtagtgaggctgtacaatgggga
caattaggtggaatcgtaggtagctggtttattacaccagttattgccggtatcgttgct
tactggattttcaccagtacacagaagttgatcttcgatacggctgagccaatgaaaaat
gcgcaaaaatacggtcctttctatatggcgttaaccgcttttattttaagtatcgttacc
atgactaaaggtctgaagcacgttggtttacacttaaccactacggaaaccgtgttaatc
tcttcagctatcgctgcggttgccgttgttgcttgttacttctacttccgtagcgaagca
tttgcaaaacgcgctcaaggagcggcattcggtggtgtagaaaaagtatttagtatctta
atgttattaaccgcttgttcaatggcattcgcacatggttcgaatgacgttgcaaatgct
gtaggtcctctttcagcggtggtatcaatcgtagaaagtggcggtatggtgagtggtaaa
gcggcattggcgccgtggatcttacctttaggtgctgcaggtattgctgctggtatgctt
atcatgggctacaaagtaatgggtacaatgggtaccggtattaccgacttaacaccaagc
cgtggattctcagctgaatttgcttgtgcaactactgtggttatcgcatctggtaccgga
ttaccgatttcaaccacacagacaattgttggtgcaattttaggtgtgggctttgctcgc
ggtattgcagcattaaacttaggtattattcgtaatatcgttgcttcgtgggtaataaca
ttacctgctggcgcaattatcgctattgtgatttatgaaattctattagcgattttctat
taa

DBGET integrated database retrieval system