KEGG   Actinobacillus suis H91-0380: ASU2_04465Help
Entry
ASU2_04465        CDS       T02262                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
asi  Actinobacillus suis H91-0380
Pathway
asi00670  One carbon pool by folate
asi01100  Metabolic pathways
asi01120  Microbial metabolism in diverse environments
asi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:asi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ASU2_04465
Enzymes [BR:asi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     ASU2_04465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR Radical_SAM DUF4252
Motif
Other DBs
NCBI-ProteinID: AFU19031
UniProt: K0G451
Position
974321..975199
Genome map
AA seq 292 aa AA seqDB search
MSYAKEIDHLNQSVADLNGQINVSFEFFPPKNEKIETMLWDSIHRLKALKPKFVSVTYGA
NSGERTRTHSIVKNIQQETGILAAPHLTGIDASPDELRTIAQDYWDNGIRNIVALRGDEP
AGYAKKPFYAADLVRLLKEVADFDISVAAYPEVHPEAKSTQADLIYLKQKIEAGANRAIT
QFFFDIDSYLRFRDRCATVGIDVEIVPGILPVSNFKQLEKMAKVTNVRIPSWMQKMYQGL
EDDQTTRNLVGASIAMDMVKILSKEGVKDFHFYTLNRSELTYAICHTLGVRP
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagctatgctaaagaaattgatcatttaaatcaaagtgttgcagacttaaacggtcaa
attaacgtttcatttgaattttttccgcctaaaaatgaaaaaatagaaaccatgctatgg
gactctattcaccgcttaaaagcgctaaaacctaaatttgtttccgtcacttatggcgca
aactccggcgaacgaacacgcacgcactccattgtaaaaaatatccagcaagaaaccggc
attttagctgcaccgcatttaaccggcattgatgccagccctgatgaattacgtacaatc
gctcaagattattgggataacggcattcgtaatattgttgcactccgaggagacgagccg
gctggctatgcgaaaaaaccattttatgcagcagatttagtgagattattaaaagaagtg
gctgattttgatatttcagttgccgcttaccccgaagtacatccggaagcaaaatcaacg
caagccgatttaatttacttaaaacaaaaaattgaagccggcgccaatcgcgcaatcact
caatttttctttgatattgatagctaccttagatttcgtgaccgctgtgccaccgtaggt
attgatgttgaaatcgtaccgggtattctgcccgtttctaatttcaaacaattagaaaaa
atggcaaaagtgaccaatgtgagaattccaagctggatgcaaaaaatgtatcaaggtttg
gaagacgatcaaacaactcgcaatttagtcggggcaagcatcgcaatggatatggtcaaa
attctctcaaaagaaggtgtgaaagattttcacttttatactttaaaccgttccgagctt
acttacgccatttgtcatacgctcggcgttcgtccatag

DBGET integrated database retrieval system