KEGG   Actinobacillus suis H91-0380: ASU2_07695Help
Entry
ASU2_07695        CDS       T02262                                 

Definition
(GenBank) PutA protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
asi  Actinobacillus suis H91-0380
Pathway
asi00010  Glycolysis / Gluconeogenesis
asi00053  Ascorbate and aldarate metabolism
asi00071  Fatty acid degradation
asi00280  Valine, leucine and isoleucine degradation
asi00310  Lysine degradation
asi00330  Arginine and proline metabolism
asi00340  Histidine metabolism
asi00380  Tryptophan metabolism
asi00410  beta-Alanine metabolism
asi00561  Glycerolipid metabolism
asi00620  Pyruvate metabolism
asi00625  Chloroalkane and chloroalkene degradation
asi00903  Limonene and pinene degradation
asi01100  Metabolic pathways
asi01110  Biosynthesis of secondary metabolites
asi01120  Microbial metabolism in diverse environments
asi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:asi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASU2_07695
   00053 Ascorbate and aldarate metabolism
    ASU2_07695
   00620 Pyruvate metabolism
    ASU2_07695
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ASU2_07695
   00561 Glycerolipid metabolism
    ASU2_07695
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ASU2_07695
   00310 Lysine degradation
    ASU2_07695
   00330 Arginine and proline metabolism
    ASU2_07695
   00340 Histidine metabolism
    ASU2_07695
   00380 Tryptophan metabolism
    ASU2_07695
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ASU2_07695
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ASU2_07695
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ASU2_07695
Enzymes [BR:asi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     ASU2_07695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFU19677
UniProt: K0FYR7
Position
complement(1718712..1720034)
Genome map
AA seq 440 aa AA seqDB search
MNQQQIANLVQAQRDFFNSNATKPLAFRKAQLQRLKAMLIENDQAILTALFNDLNKPESE
ARLTEIDMLVHEIDFMLENLDELAKPKSAGQSEITEMVMGAKVDAQIIYEPYGVFLNISP
WNYPIQLSISPIIGAMAAGNTIILKPSEFTVHSSALLAKLVAEYFEPNYFTVVEGDVAVN
QQLLTEKFDYIFFTGSVPVGKIVMAAAAKHLTPVTLELGGKSPCIVDETADLKLAAERIL
FGKVFNSGQTCIAPDYLLVQENVKDRLVEEIRQRINAIYQGKNPTEIADHVKVVTPRHYQ
RLKAFLNDGRVLVGGEYNDETSKLAFTLIDEVNWQSPVMQEEIFGSIFPMLTFKTMNEAI
AQVKANAKPLALYLFTQDKATEEQVLNEVSFGGGCINDTFMHVTHAGLPFGGVGDSGMGG
YHGAHSFYEMSHGKSVIKRI
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacaacaaattgcaaatctcgtgcaagcgcaacgagatttttttaatagtaac
gcaaccaagccgttagcgtttcgcaaagcgcaattacagcgcttaaaagcgatgttaatt
gaaaatgatcaggcaattttaacggcgctttttaacgacctaaataaaccggaatcggaa
gcccgtttaaccgaaatcgatatgctcgtgcatgagatcgattttatgttagaaaacttg
gatgagttggcgaaaccaaaatcggcagggcagtcagaaattactgaaatggtgatgggc
gcaaaagtggacgcacaaattatttatgagccgtatggtgtgtttttaaatatttcaccg
tggaattacccaatacagctttcgatttcgccgattatcggtgcgatggcggcaggtaat
acgattatcctaaaaccttcggaatttaccgtacattcttcagcacttttggctaaatta
gttgcggaatacttcgaaccgaattacttcaccgtagtggaaggcgatgttgcggtaaac
caacagctattgaccgagaaattcgactatattttctttaccggtagtgtgccggttggg
aaaatcgtgatggcggcggcggcaaaacatttaacgccggtaacgctggaattaggcggg
aaaagcccttgtatcgtggatgaaacagcagatctgaaattagcagcggaacgtatttta
ttcggcaaggtgtttaatagcggacaaacttgtattgcgccggactatttattggtgcaa
gagaacgtaaaagatcgtttagttgaggagatcagacagcgtatcaatgcgatctatcag
ggtaaaaatccgaccgagatagcggatcatgttaaagtagttacccctcgtcattatcaa
cgtttaaaagcgtttttaaatgacggacgagtgttagtcggcggagaatataacgatgaa
accagcaaactggcgtttactttgatcgatgaagtgaattggcaaagcccggtaatgcaa
gaagaaatcttcggttctattttcccgatgttgacttttaaaacgatgaatgaagcgatt
gctcaagtgaaagcaaatgctaaaccgttggcgctgtatttattcacgcaagacaaagca
acggaagagcaagtattaaatgaagtgtcattcggtggcggctgtattaatgataccttt
atgcatgtaacacacgccggcttgccttttggcggtgtgggtgatagcggtatggggggg
tatcacggcgcacacagtttctatgaaatgagtcatggaaaaagcgtgattaaacgcatt
taa

DBGET integrated database retrieval system